SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050372 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050372
Domain Number 1 Region: 277-564
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000188
Further Details:      
 
Domain Number 2 Region: 7-136
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-18
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050372   Gene: ENSBTAG00000040559   Transcript: ENSBTAT00000052445
Sequence length 590
Comment pep:known chromosome:UMD3.1:18:62685339:62699998:1 gene:ENSBTAG00000040559 transcript:ENSBTAT00000052445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATVSQNTTNTTITVKGLEAGTLYEFSVYAVKDGFNSSVHLNACTAPSEVTALQKQNQTDS
SITLQWEAPADPQPQFYVYWVHWASRGYPQRKRGPQGHQDNQTGSTNRTHYTVEALVPGT
WYCFNVWAESYGVHGYKQSLNASTAPDPANITSCVITSGGHEVILAWSCPQGGYEAFELE
VKGQLGPQNSSSCGDAVKVSLLRPAQSSSATVMTVWDEMRAPSASVACHMESGHAGVIAG
AVVSVLLLLILVGLLLFFLKRRRRKREKKPAPKDLEIRFPGDILAEDFAEHVWRNERDSN
YGFAEEYQQLALEDHGQSQTVASALENSGKNRYRNVLPYDWSRVPLQALLGQPGSEYINA
SFIPGLWSPREFIAAQGPLPQTVGDFWRMVWEQQSHTLVMLTNCVESGRVKCEHYWPLDA
QPFTHGHLQVTLVGEEVAENWAVRNLKLCHVQQQKTLPVRQFHYMTWPDHGVPHSPDPLL
AFWRMLRQWLDQTVGGGPPIVHCSAGVGRTGTLIALDVLLRQLECEGLVGPFGYVKKMRE
SRPLMVQTEAQYVFLHQCILQFLQQSATVRAQKGATYENLLMENGAATEA
Download sequence
Identical sequences F1MGT8
ENSBTAP00000050372 ENSBTAP00000050372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]