SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050537 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050537
Domain Number 1 Region: 36-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-23
Family SCAN domain 0.0023
Further Details:      
 
Domain Number 2 Region: 337-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 299-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000851
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050537   Gene: ENSBTAG00000038947   Transcript: ENSBTAT00000053280
Sequence length 415
Comment pep:known chromosome:UMD3.1:18:65278553:65280012:1 gene:ENSBTAG00000038947 transcript:ENSBTAT00000053280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDLRISFEGEPSRRGPGPENSPTQGSAIQEEEGIPEFPSTQLNLLRDSNNLSARHELQ
RLYHLFHSWLQPEKHSKDEIISHLVLEQFMISRNCSDRSTLQEKWKASGRNLEKLMEDLT
DDGMEVPGLVHVHMQGREALFCENMPLRQVIIHLTKQLPAGTPTRENAGTLSWTPQDTSL
ETGQRNEGKENDGNISVKSDSITSPSNQIPSLIIVQEENHLRLEEGGVSLENPRNSRRGA
GPGPSRPQDGSLKGPSSQDVLMEVERDQVTPEPVSTLQSSEGTSARGEPQERSLRAPEVY
RCERCPKTFRYSSRFRVHQKRHNNERTYICAECGKGFFQASDLHVHQRIHTGEKPFVCST
CEMAFTHKTNLRTHERTHTGEKPYECSLCQRRFRQSSTYHRHRRFHQKATLKSAP
Download sequence
Identical sequences E1BHA9
ENSBTAP00000050537 ENSBTAP00000050537 9913.ENSBTAP00000050537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]