SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050538 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050538
Domain Number 1 Region: 133-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-26
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 48-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 1-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 175-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 95-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000243
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050538   Gene: ENSBTAG00000039969   Transcript: ENSBTAT00000054166
Sequence length 248
Comment pep:known chromosome:UMD3.1:18:60352473:60353630:-1 gene:ENSBTAG00000039969 transcript:ENSBTAT00000054166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHKRIHTGEKPYRCNECGKAFRKHSNLTQHKVVHTGEKPYRCNECGKAFSVHSALRNHQI
IHTGEKPYKCDVCGKVFSRNSILASHQRLHTGEKPYKCKECGKSFMQLSSLSRHQRRHSG
KKPSKCNVLCGKAFIQHSSLVAHQRIHTGERPYKCNKCDKAFTQNSQLWRHERTHIGEKP
YQCNECGKAFTDGSHLNRHKIIHTGEKPYKCHECGRAFTQFTNLGRHQKIHTERKHKPSL
CGSAFIKS
Download sequence
Identical sequences F1MC96
ENSBTAP00000050538 9913.ENSBTAP00000050538 ENSBTAP00000050538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]