SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050560 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050560
Domain Number 1 Region: 45-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.97e-32
Family SCAN domain 0.0000921
Further Details:      
 
Domain Number 2 Region: 298-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-18
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 377-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-17
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050560   Gene: ENSBTAG00000040168   Transcript: ENSBTAT00000056475
Sequence length 439
Comment pep:known chromosome:UMD3.1:23:30206789:30211745:-1 gene:ENSBTAG00000040168 transcript:ENSBTAT00000056475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIDSKEILCLDMQAPKVWEELLTEKVEAESHPQKQESRLKRSNSLAREISRRHFRQLCY
QETPGPRQALTRLRKLCYQCLRPHVSTKKQILDLLVLEQFLSILPQELQGWMREHCPESG
EEAVILLEDLERELDEPQHEMVAYRQEQEVLSKAHMSLALQSQPKEPQLTLVSAQEPHPI
GETVLLRSLSKRAVLVSLVAHFFSADTFLFCKPVVISQLKGSGEPWSHPRGVLRGGMTQT
EDRELVLRKHCPKRVEPCGKVSYGLTWEESQQGPQHGEVSEHKGGVERHWGSPVGTGPHR
YEECGKSFAQSSGLVRHQRVHTGERPYECNECGKTFSRSSGLLNHRGIHNIQKRYHCKEC
GKAFSQSAGLIQHKRIHKGEKPYQCSQCNKSYSQHSFLIEHQRSHTGERPHHCNQCGKSF
NHHCNLIRHQKIHLVAELA
Download sequence
Identical sequences E1BGV5
ENSBTAP00000050560 ENSBTAP00000050560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]