SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050573 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050573
Domain Number 1 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 645-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 589-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 169-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-23
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 691-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 1-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-18
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 12 Region: 113-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 13 Region: 80-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000114
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 14 Region: 328-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000244
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050573   Gene: ENSBTAG00000038088   Transcript: ENSBTAT00000055325
Sequence length 744
Comment pep:known chromosome:UMD3.1:18:65429749:65445944:-1 gene:ENSBTAG00000038088 transcript:ENSBTAT00000055325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVTFEDVAVYFSWEEWRLLAEAQRSVYLDVMLENYALIASLVFSLFKQIVLFLLNCREPY
ILNTSDIKHPAPSRSHWKRRECRKALSPKHTLVQDQGVHTGIPCFVCSECGKAFRYKSSF
VVHQRVHAGKNLHVCGECGKSFSHSSVFIPHRRVQTGERPYKCSDCVKSFTSMSALCYHQ
RSHTGERPYICSDCGKSFISSSDLRYHQRVHSGERPHECSECGKSFITRTALRYHHRVHT
GERPYECSECGKSFTRKNNLIIHLRVHSGERPYECSECGKSFTFSSSLRYHHRVHTGERP
YECTECGKSFNNRWTLIRHQRIHTGEKPYVCNKCGKSFSCSSTLQYHERGHLGERPYGCD
ECGRSFTTSSALRYHQRIHTGERPYECNECGKSFISKSDLHYHQRVHSGERPYECSECGK
SFIRRNNLLLHQRVHTGERPYKCSECGKSFNNRWTLIQHQRVHTGEKPYVCSECGKSFTS
SSTLCYHQRVHAGKRPYECSECGKSFTSSSTLRYHQRVHTGERPYECSECGKSFTFSASL
RYHHRVHTGERPYECNECGKSFKDRSQFNKHRRAHTGERPYECNECGKSFTNSSILIRHQ
RVHTGERPYVCSECGKSFTSSATLSYHQRVHAGKRPYECSKCGKSFTSSSTLRYHQRVHA
GDRPYECSECGKSFISSSKLRYHQRVHTGERPYVCSECGKSFRDSSQFSQHRRGHTGERP
YECRECGKFFMRKSTLSQHQRVHT
Download sequence
Identical sequences F1MBW2
ENSBTAP00000050573 ENSBTAP00000050573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]