SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050706 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050706
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-26
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 205-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 346-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000492
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050706   Gene: ENSBTAG00000000801   Transcript: ENSBTAT00000053429
Sequence length 564
Comment pep:known chromosome:UMD3.1:18:63903404:63910967:-1 gene:ENSBTAG00000000801 transcript:ENSBTAT00000053429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFQDLVTFRDVAVNFSQEEWEWLNPAQRSLYRTVMLDNYRSLVSLGVSVSKPDVISLLE
QGKEPWMVKEEGPRGACPGWEYTFKNKEFPSKQVIYEESSKVMMMGRSHLSYNLNCSSWR
GDSKSKDWFKNQLGTQEVHASQLIVTHREILNEDHSNEYTKSWQTFHQDTIFDIKQKRNK
HEPQKRSYRKKPIEMKHKKVYVEKKLLKCNECEKVFNQSSSLTLHQRIHTGEKPYACVEC
GKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAF
SQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCHVCAKAFSHRG
YLIVHQRIHTGERPYECKECRKTFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQ
HQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRI
HTGEKPYECNICGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHERIHTME
SFLTLSSPSASMSSQLPRPVGFIS
Download sequence
Identical sequences F1ME08
ENSBTAP00000050706 ENSBTAP00000050706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]