SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050759 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050759
Domain Number 1 Region: 554-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 610-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.61e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 666-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 498-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 778-834
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-22
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 6 Region: 722-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 834-889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.62e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 9 Region: 444-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000081
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 387-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000649
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000050759
Domain Number - Region: 244-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000111
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 308-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000159
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050759   Gene: ENSBTAG00000040209   Transcript: ENSBTAT00000055043
Sequence length 905
Comment pep:known chromosome:UMD3.1:18:52582623:52592461:-1 gene:ENSBTAG00000040209 transcript:ENSBTAT00000055043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPVSFKDVAVVFTEEELGLLDSAQRRLYQEVMLENFQNLLSVGNQPFKPELIFQLEREER
LMMESQRGGCSGTKSPHNMESIQEVGLSCFSPKDLSTWQSWQRGAGRLTGCQDSMRNFQE
NISQLQKQGDSPCQVWAGIPIQISEDENCVLTHIGDGSNDIKNQEFPSWRAHHSWRKMYL
TESRNYQCRCQQVSKENDFCKSDSISWISHHGDNLGVHRTGKNSSCHDCGEDVMKVSLLN
HIQTGQKPYPGNEFRKAFSDDSSSEVHQQLDLEGKPCTYSACEKDCSYRSVLHIHQSVCR
GDHCIFENSHLQSHQKGHAKEKPFKCEYSESINQCSSHNTYQLIPRGETSDRYSVYEKGF
SHSLDLSSIVRVYIEEESHESEENGNAFNENSCLQAHQKIHTEEKRYTDMECEKGFICNS
DLNIQHRVHMEEVPYNSEACANGFSLASHFQNLQIVHTREQPYKRYTCGNSFSQSSYLQA
HQKIHIGEKPYKVCGNGFNWNSKLKDHQRVHTGEKPYKCSACGKGFSHRSVLNVHQRVHT
GEKPYKCEECDKGFSRSSYLQAHQRVHTGEKPYKCEACGKGFSRNSYLQGHQRVHTGEKP
YKCEECGKGFSRSSHLQGHQRVHTGEKPFKCEECGKGFSWSFNLQIHQRVHTGEKPYKCG
ECEKGFSKASTLLAHQRVHTGEKPYQCDECGKSFSQRSYLQSHQSVHTGERPYICEVCGK
GFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAHQRVHTGGKPYKCAVCTKGFSE
SSRLQAHQRVHTEGRPYKCEQCGKGFSGFSSLQAHHRVHTGEKPYKCEVCGKGFSQRSNL
QAHQRVHTGEKPYKCDACGKGFRWSSGLLIHQRVHSGDKFYTSEEYSKGYPSSENPYRSE
ENVMF
Download sequence
Identical sequences F1MDI6
9913.ENSBTAP00000050759 ENSBTAP00000050759 ENSBTAP00000050759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]