SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051030 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051030
Domain Number 1 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 235-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.00072
Further Details:      
 
Domain Number 5 Region: 442-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 174-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-17
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 8 Region: 495-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000231
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000051030
Domain Number - Region: 135-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00298
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051030   Gene: ENSBTAG00000040157   Transcript: ENSBTAT00000054433
Sequence length 525
Comment pep:known chromosome:UMD3.1:7:14692183:14699346:-1 gene:ENSBTAG00000040157 transcript:ENSBTAT00000054433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SITFEDVAINFTQKEWALLNSSQRMLYKDVMLENYRNLASLGHQLCKPLITHLEQEDEMK
IVERRIHQNTCSYEMILLKTKRPQQEQGILEKYTLNGKKQEEQTLGGNTIQCREIVETLS
VKSSIIHNKRIYPGKKLHRYPDSAEALGESSHLKSHERILPQKKSYNCETDENSFIRSSN
LASHKRQHTGEGSCECSDCGKVLNSISHLKKHETTHIREKPFECSQCGKVLQSHGSIKLH
MRTHTGEKPFKCYQCGKSFSSSSYLARHKRIHTGEKPYECHDCGKTFRDSSLLRQHARTH
SGEKPYKCNQCNKTFSRNDRLTTHQITHTGEKPYKCNDCGRTFSVLLYFKQHKRIHTGEI
VTECSLCGKALKSKASLKTHMRIHTGEKPYKCNQCGKAFRMSSNLTTHKKIHTGEKPCKC
NDCGKAFRDRSCLKEHVRIHTGEKPFTCNQCGRAFRVKSFLMLLHIRTHTGEKPYECNQC
GKSFSVKCNLTVHKRIHTGEKLYNCKICGLSFSKPLPFQRHERTH
Download sequence
Identical sequences G5E6D7
ENSBTAP00000051030 ENSBTAP00000051030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]