SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051111 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051111
Domain Number 1 Region: 135-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.82e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 191-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 93-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 289-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051111   Gene: ENSBTAG00000037375   Transcript: ENSBTAT00000054956
Sequence length 350
Comment pep:known chromosome:UMD3.1:18:64758707:64766511:-1 gene:ENSBTAG00000037375 transcript:ENSBTAT00000054956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNLALEGGLCGPEVLRTNPGQTLCGTDVKSHQHVGEKLMRRDLGKALMRNCTVHALEKA
FKCQEARKDFPGTSDHVQHQVKPQMMEFVAEFHNGEKRFKCNECGKLFYRKSRLAQHHRV
HTGEKPYECSECGKVFRCSSSLAIHRRIHTGERPYECRECGKFFRQHSQLVVHQRIHTGA
RPYECSECGKTFSTKTKLDQHRRVHTGERPYECGECGRTYTCKRMLIQHQLVHTGEWPHE
CSECGKAFRYMASLVMHRRIHSGERPYECNECGKSFRQRAHLQVHNRIHTGAKTFECSEC
GKCFSQNSILTTHQRVHTGERPYKCCDCGKCFSQKSTLIKHLNLHWRKVT
Download sequence
Identical sequences F1MXP4
ENSBTAP00000051111 ENSBTAP00000051111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]