SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051115 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051115
Domain Number 1 Region: 482-572
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-19
Family Canonical RBD 0.00000482
Further Details:      
 
Domain Number 2 Region: 391-475
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.44e-16
Family Canonical RBD 0.00000943
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000051115
Domain Number - Region: 290-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000555
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051115   Gene: ENSBTAG00000006756   Transcript: ENSBTAT00000057156
Sequence length 844
Comment pep:known chromosome:UMD3.1:7:52218128:52244915:1 gene:ENSBTAG00000006756 transcript:ENSBTAT00000057156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSFQQSSLGRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGM
SSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSAR
DLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEE
KRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDDSFFGETS
HNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGLLPKGYPHLCSICDLPV
HSNKEWSQHINGASHSRRCQLLLEIYPEWNPDTDTGHTMGDPFMLQQSTNPAPGILGPPP
PSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE
PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKP
EGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEME
TREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPD
GKESPSDKKSKTDGSQKTESTAEGKEQEEKSGEDGEKDTKDDQAEQEPNMLLESEDELLV
DEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAVKKDANASASGAAKKKLKKRR
FPGNMEGFVTLDEVGDEEDSELQKLRKSGMAFKSGDKNDDGLVEIKVDKIEELDQENEAA
LENGIKNEENTEPGAESAENADDPNKDTSENADGQSDENKEDYTIPDEYRIGPYQPNVPV
EISE
Download sequence
Identical sequences F1MXI4
XP_004008896.1.66739 XP_005683065.1.57651 XP_005971897.1.78601 XP_012006086.1.54773 XP_017905806.1.57651 XP_019820570.1.53367 XP_019820571.1.53367 ENSBTAP00000051115 ENSBTAP00000051115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]