SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051183 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051183
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily RING/U-box 2e-17
Family ZZ domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000051183
Domain Number - Region: 76-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.041
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051183   Gene: ENSBTAG00000020630   Transcript: ENSBTAT00000055279
Sequence length 381
Comment pep:known chromosome:UMD3.1:11:49779932:49811675:-1 gene:ENSBTAG00000020630 transcript:ENSBTAT00000055279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISFFIGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVD
FDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD
PNHVTDDFAAHLTLEHRAPRDLDESSGVRHVRRMFHPGRGLGGPRARRSNMHFTSSSTGG
LSSSQSSYSPSNREAMDPIAELLSQLSGVRRSAGGQLNSSGPSASQLQQLQMQLQLERQH
AQAARQQLETARNATRRTNTSSVTTTITQSTATTNTANTESSQQTIQNSQFLLTRLNDPK
MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDERGEMADFGAMGCVDIMPLDV
ALENLNLKESNKGNEPPPPPL
Download sequence
Identical sequences F1MWM6
ENSBTAP00000051183 ENSBTAP00000051183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]