SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051211 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051211
Domain Number 1 Region: 641-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-24
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 7 Region: 221-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 687-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 10 Region: 183-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 11 Region: 352-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000759
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 12 Region: 436-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000177
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 13 Region: 269-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000762
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051211   Gene: ENSBTAG00000040063   Transcript: ENSBTAT00000057256
Sequence length 740
Comment pep:known chromosome:UMD3.1:18:47466374:47473766:-1 gene:ENSBTAG00000040063 transcript:ENSBTAT00000057256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVPLQGSVSFRDVAVDFSREEWQQLDLDQKNLYRDVMLETCSHLLSIGYQVPETKVFMLE
QGKEPWALQGEGPYQSCPEELWQIGDQIESYHQRENRSLRNKVLTIQRDYAYKGITKIIR
VSQNIPSPKRPHHQCDLFGSALSCNLDLCNNNRNSGSKNINKITEYGKISSYTKQECTPT
GEKLYVCIDCGKAFVQKPEFITHQRTHTREKPYKCSECGKAFFQVSSLFRHQRIHTGEKL
YECSECGKGFSYNSDLSIHQKIHTGERHHECSECGKAFTQKSTLKMHQKIHTGERSYICI
ECGQAFIQKTHLIAHRRIHTGEKPYKCSNCGKSFISKSELVIHQRIHTGEKPYECSDCGK
AFTQKSALTVHQRIHTGEKSYICMKCGLAFIQKAHLIAHQIIHTGEKPYKCGHCGKSFTS
KSQLHVHKRIHTGEKPYTCTKCGKAFTNRSNLITHQKTHTGEKSYICSKCGKAFTQRSDL
ITHQRIHTGEKPYECSTCGKSFTQKSHLNIHQKIHTGERQYECHECGKAFNQKSILIVHQ
KIHTGEKPYVCTECGRAFIRKSNFITHQRIHTGEKPYECSDCGKSFTSKSQLLVHQPIHT
GEKPYVCALCGKAFSGRSNLSKHQKTHTGEKPYICSECGKTFRQKSELIIHHRIHTGEKP
YECSDCGKSFTKKSQLQVHQRIHTGEKPYVCAECGKAFTDRSNLNKHQTTHTGDKPYKCV
VCGKGFVQKSVLNVHQSIHT
Download sequence
Identical sequences F1MUP0
ENSBTAP00000051211 ENSBTAP00000051211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]