SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051224 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051224
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-36
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 408-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.77e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 743-800
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 800-856
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 912-968
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 631-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 856-912
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 464-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 575-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 688-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 212-263
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 13 Region: 367-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.88e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 953-1003
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000413
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051224   Gene: ENSBTAG00000037803   Transcript: ENSBTAT00000055475
Sequence length 1039
Comment pep:known chromosome:UMD3.1:22:16470249:16490038:1 gene:ENSBTAG00000037803 transcript:ENSBTAT00000055475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENWAHNALRQEGLVKGKDDTWKWGTSFQGSSSTVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQIHRPGSGEEAVALVEEL
QKDLDGPTLKVPAFVQDQDTLQEGLSTPGIALPHAPTGSHISAEIRSNSLTDPVVFGLLQ
DPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLSPVQR
ALYWDVMLENYGNVTSLAEWETMTENEEVTSKLNISQRADSQRGISKRFQGGVPYLLDFE
EECEWQIFSSQWRNEARERDTLKKGSLCERDKKKRTPPEKRGQKWKEFEESLASDSAFSE
SLIGAEGKKLYKCDMCYKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRN
HSGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGE
RPYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYK
CDECGKTFAQTTYLVDHQRLHSTENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKC
GKIFTSKSSLIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVF
ILKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSK
SFMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECNECGRAFSSNRNLIE
HKRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRI
HTGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHVCRKVLTSSRNLMVHQRIHTGE
KPYKCSECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYG
CNDCNKVFRQRKNLTVHQKIHTDEKNCECDESEKEFSQTSNLHLQPKIHSLEDFRSYSLG
SKFSWVQNANESKIKIQKI
Download sequence
Identical sequences E1BKY0
ENSBTAP00000051224 9913.ENSBTAP00000051224 ENSBTAP00000051224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]