SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051264 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051264
Domain Number 1 Region: 278-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 240-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-17
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051264   Gene: ENSBTAG00000039628   Transcript: ENSBTAT00000054167
Sequence length 377
Comment pep:known chromosome:UMD3.1:18:63820995:63823800:1 gene:ENSBTAG00000039628 transcript:ENSBTAT00000054167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRNKQKHKTWTIVCIQGQKYLVRDPNIEMVEAKAGHMDDERHLCGGPQPSSRVIPPEDG
QEGSQELQNLPGATNLSREQDERALPPETVPETGELEGQTPRENLEKDLLEDRGETKTLQ
SEAPQLLKGPGEYSKPWNPAEGFWKHREIEESSRRTLSSCVPEADVSTTGGSRRGPLKNR
RHMKRKRDSSPTCQDVCQEAATCLDQGEFSGQLGSHSIDVSGTVGPTSLPEGAETPGRAP
SECRMCKKSFPYQSQLILHQRTHTGERPFQCDICAKGFIQPSDLRVHERIHTGEKPYSCD
LCLKKFTHDSTLRAHKRTHTQEKPFRCEHCDRAFSHRGNLNVHRRIHSGLKPYVCPECHS
AFRQLGTFKRHQKIHSR
Download sequence
Identical sequences G3X897
ENSBTAP00000051264 ENSBTAP00000051264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]