SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051281 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051281
Domain Number 1 Region: 5-99,130-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-66
Family Calponin-homology domain, CH-domain 0.0000731
Further Details:      
 
Domain Number 2 Region: 8018-8173
Classification Level Classification E-value
Superfamily Spectrin repeat 8.31e-22
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 7798-7922
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-19
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 3295-3417
Classification Level Classification E-value
Superfamily Spectrin repeat 5.91e-19
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 5 Region: 6934-7078
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-18
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 6 Region: 1583-1718
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-18
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 7 Region: 7374-7520
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 8 Region: 3079-3234
Classification Level Classification E-value
Superfamily Spectrin repeat 6.42e-17
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 9 Region: 7046-7190
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 10 Region: 4471-4621
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000182
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 11 Region: 2421-2550
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000223
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 12 Region: 3851-3958
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000366
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 13 Region: 8400-8511
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000838
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 14 Region: 3723-3844
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000009
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 5023-5166
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 16 Region: 2639-2766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000209
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 17 Region: 6723-6863
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000797
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 18 Region: 7588-7739
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000013
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 1364-1500
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000018
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 20 Region: 4251-4405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000275
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 21 Region: 517-657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000585
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 22 Region: 3529-3661
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000034
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 23 Region: 7927-8036
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000004
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 24 Region: 5693-5770,5881-5927
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000432
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 25 Region: 2793-2910
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000801
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 26 Region: 8476-8620
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000081
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 27 Region: 2010-2149
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000222
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 28 Region: 2207-2362
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000311
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 5890-6029
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000158
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 30 Region: 1671-1825
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000224
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 31 Region: 4918-5017
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000288
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 3937-4095
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000389
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 33 Region: 7262-7383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000008
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 34 Region: 1476-1583
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000187
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 35 Region: 1046-1186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000384
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 36 Region: 5135-5240
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000528
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 37 Region: 3444-3555
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000628
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 38 Region: 1883-2034
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000224
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 39 Region: 5435-5556
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000576
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 40 Region: 5556-5651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000144
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 41 Region: 4168-4296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000236
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 42 Region: 6518-6601
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000786
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 43 Region: 847-974
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000103
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 44 Region: 6341-6446
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000105
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 45 Region: 6039-6154
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000374
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 46 Region: 4790-4929
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000605
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051281   Gene: ENSBTAG00000009362   Transcript: ENSBTAT00000052410
Sequence length 8760
Comment pep:known chromosome:UMD3.1:9:90276613:90335558:-1 gene:ENSBTAG00000009362 transcript:ENSBTAT00000052410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRK
IKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQALSSSTSSVDSMVSSET
ASPPSKRKVATKIQGNAKKALLNWVQYIVTKQSGIEVKDFGRSWRSGVAFHSVIHAIRPE
LVDLEKVKGRPNRENLEEAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKQYP
DIHSTGSDGQENDEILPSFPSFTNSIQILKREDRLILKEMKVWIEQFERDLTRAQMTDSS
LQDKYQSFKHFRVQYEMKRKQIEHLLQPLHRDGKLSLDQALVKQAWDRVSSRLFDWHMQL
DKSLPAPLGTIGAWLYRAEVALREEITIQQVHEETANTIQRKREQHKDLLQNTDAHKRAF
HEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKL
KSWIIKYGGRDSVELLLQNYISFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENV
MKFMNETTAQWRNLSVEVRSVRSMLEEVIANWDRYGNTVASLQAWLEDAEKMLNQSEHAK
KDFFRNLPHWIQQHTAMNDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYARA
DELDRMKKEYNDCVTILSDFATEAHRKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQY
KMITKTAHLITKEISQEEANEMFATMSGLKEQLTKVKDCYSPLLSESQQLLVPLEELEKQ
MTAFYDSLGKIDEIMTVLEHEAQSSPLFKQKHQELLACQESCKKAMTQIEKGSQSVQKFV
TLSNVLKHFDQTKLQRKIADTHVAFQNMVKKTGDWKKHVETNSRLMKKFEESRAELEKVL
RVAQEGLEEKGDPEDLLKRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQRGLQEAVRK
LHKQWKDLQAEAPYHLLHLKIEVEKNRFLASVEECRAELDRETKLVPQEGSEKIIKEHRI
FFSDKGPHHLCEKRLQLIEELCLKLPVRDAVRNTPETCHVTLKELRAAIDRTYVKLVGDP
DKWKDYTSRISEFSSWISAKETQLKGIKNETIDTANQGEVKCALEEIRSGITKKGETLSW
LKSRLKILIEVSSEDEAQKQGDELAKLSSSFKALGTLLSEVEKMLSNFGDCVQYKEIVKS
SLEELITGSKEVQEEAEKILDTENLFEAQQLLLHHQQKTKRINAKKKDVQQQITQAQKGE
GGLPGRVQEELQKLESTLDSVEHSREKQERRIQVTLRKWERFETNKETVVRYLFQTGSSH
ERFLSFSSLESLSSELEQTKEFSKRTEGIAVQAENLVKEASEIPLGPKNKQLLQQQAKSI
KEQVKKLEDTLEEDIKTMEMVKNKWDHFGTNFETLSVWITEKEKELNALETSSSAMDTQI
NQIKVMIKEIESEISSITGLEEEAQSFAQFVTTGESARIKAKLTQIRRYWEELREHAQSL
QGIILGHLSQQQKFEENLKKIQQSVSEFEDKLADPVKICSSATETYKVLQEHMDLCQALE
SLTSTVAALSASARKVSNRDASIQEAATVQRSFEGLLGRAKERQTELEKLLARWQRLEKE
LSTFLTWLERCEAIASSPEADISADRVKVESELQSIQVLQNEVVSQASIYSNLLQLKESL
FSVASKDDVKMMKLQLDQLDERWRDLPQIISKRINFLQSVVAEHQQFDELLLSFSVWIKL
FLSELQTTSEISIMDHQAALTRHKDHAAEVESKKGELQSLQGHLAKLGALGRAEDLHLLQ
GKAEDCLQLFEEASQVVERRQHALSQLAEFLQSHASLSESLHQLRQTVESTHSMNKKQSD
LLERDLNDAIRNVKTLESAAISLDGLLTKAQYHLKSGGSEQRTSCRATSDHLSVELERIQ
NLLGTKQSEADALAVLKKAFRDQKEELLKSIEDIEERTDKERLKDLTRQALQQRLRVFNQ
LEDELNSHEHELCWLKDKAKQIAQKDVAFAPEVDKEINRLEVTWNDTKKLIHENQGQCCG
LIDLMREYQNLKSAITKVLENASNVIATRTTVKDQEDLKWALSKHEAAKNEMCNKQKDLD
NFTSKGKQLLSELKKIHSGDFIVVKTDMESTVDKWLDISEKIEENMDRLRVSLSIWDDIL
TSKDEIDGWSNHSVPQLTESISNLNDSLRAEEFLKEFESEVKKKALRLEELHSKVNDLKE
LTKNPETPPDLQFIEADLRQKLEHAKEITEEAKGTLKEFTAQSAQVEKFINDTATWLTKL
EESLMNCAQTETCEGLKKVKDIQKELQSQQSNISMTQENLNSLCRKYHSVELGSLGSAMT
GLIKRHEAVSQSCSKTQASLQDSLEKHFNESMQLFQEWFSGIKAAAKESSDRTGDSKVLE
AKLRDLQKQNILDSVSDGQSKLDAVTREGQTLYAHLSKQIVSSIQEQVTKANEEFQAFLK
QCLKDRQALQDCALELGSFEDQHRKLNLWIHEMEERLSTENLGESKQHIPEKKNEVHKIE
MFLGELLAARESLDKLSQRGQLLSEEGHGAGKESRLCSQLLTSYQNLLRMTKEKLRSCQV
ALQEHEALEEALQSMWSWVKDMQDRLASAESTVGSKDALERRLLQVQEILLMKGEGEVKL
NMAIGKGEQALRSSNKEGQKVIQTQLQTLKDVWANIVDSSIHAQSTLESVISQWNDYLEW
KNQLEQWMESVDQKVEHPLQPQPGLKEKFSLLDHFQSVVSEAEDHAGALQRLTAKARELY
QKTEDEALTDTAQEELKTQFNDILTVSKEKMRKVEEIVKDHLMYLDAVQEFTDWLHSAKE
ELHRWSDMSGDSPATQKKLSKIKELMDSREIGASRLSRVESLAPAVKRNTTASGCELLDT
EMQALRADWKQWEDSVFQTQTSLENLVSQMALSEQEFSGQVAQLEQALEQFSALLTSWTQ
QLALLEGKNTDKELVECWQKGREILDALQKAEPQTENLKSQLNELCRFSRDLSTYSGKVS
GLIKEYNCLCLQASKGCQNKEQILQQRFLRAFKDFQQWLVNAKITTAKCFDIPQNINEVS
TSLQKIQEFFSESENGQHKLNTMLSKGELLCTLLTKEKASGIQAKIATAKEDWKNFHSNL
HQKESALENLKIQMKDFEVSAEPVQDWLSKTEKMVHESTNRLYDLPAKRREQQKLQSVLE
EINCYEPQLRRLKEKAQQLWEGQAASRSFMHRVSQLSSQYLALSNVTKEKVSRLDRIVAE
HNQFSLGIKDLQDWMMDTVHMLDSYCHPTSDKSVLDSRMLKLEALLSVKQEKEIQMKMIV
TRGESVLQNTSPEGIPAIQQQLASVKDMWASLLSAAIRCKSQLEGALSKWTSYQDDVRQF
CSWMDGVEASLNASERQHAELREKTAALGKAKLLNEEVLSHGSLLETIEVKGAGMTEHYV
TQLEFQDLQERYGAIRERTKEAVTKSEKLVRLHQEYQRDLKAFEAWLEKEQDKLDQYSVL
EGDAHTHETALRDLQELQVRCAEGQALLNSALHTREEVIPSGIPQTEDRALESLRQDWQA
YQQRLSETRTQFNNVVNKLRLVEQKFQQVDEWLKTTEEKVSLRTARQSSRAAKEMQLHQM
KKWHEEITAYRDEVEEVGARAQEILDESHVSSRMGCQATQLTSKYQALLLQVLEQIKFLE
EEIQSLEESELSLSSYSDWYSSTHKNFKNVAAKIDKVDKAMMGKKMKMLEGLLKDMEKGQ
SLLKSAREKGERALKYLEDAEAETLRKEIHDHVERLKELTSTVRKEHMTLEKGLHLTKEF
SDKYKALTQWIAEYRDILHGPEEPKMELYEKKAQLSKYKSLQQTVLSHEPSVKSVREKGE
ALLELVQDVTLKDKIDQLQSDYQDLCSAAKEHVCSLEAKVRDHEDYNSELQEVEKWLLQM
SGRLVAPDLMETSSLETITQQLARHKAMMEEIAGFEDRLNDLKTKGDNLISQCADHLQAK
LKQNVHAHLQGTKDSYSAICSTAQRVYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDLKP
GANPPLSRAEAVKQVKHFRALQEQARTYLDLLCSMCDLSNSSVKTTAKDIQQTEQMIEQR
LAQAQNLTQGWEEIKHMKAELWIYLQDADQQLQNMKRRHSELELNIAQNMVSQVKDFVKK
LQCKQASVNTITEKVDELTKKQESPEHKEISHLNDQWLDLCLQSNNLCLQREEDLQRTRD
YHDRMNVVEGFLEKFTTEWDNLARSDAESTAVHLEALKKLALALQERKKAIEDLKEQKQK
MIEHLNLDDKELVKEQTSHLEQRWFQLEDLVKRKIQVSITNLEELSVVRSRFQELMEWAE
EQQPNIAEALKQSPPPDMAQNLLMDHLAICSELEAKQMLLKSLTKDADRVMADLGLKERQ
IIQKALSDAQRHVSSLSDLVGQRRKYFNKALSEKTQFLMAVFQATSQIQQHEHKIMFREH
ICLLPDDVSKQVKTCKSAQASLKTYQNEVTGLWAQGRELMKGVTEQEKSEILGKLQELQS
VYDTVLQKCSHRLQELEKNLVSRKHFKEDFDKACHWLKQADIITFPEINLMNETAELHTQ
LAKYQHILEQSPEYENLLLSLQRTGQAILPTLNEVDHSYLDEKLHALPLQFNVIVDLAKD
KFYKQEAMLARKEYASLIELTSQSLRDLEDQFSRMSQIPGHLSVEEAMSLQDGWRALGGE
VAGLTEAVDELNQKKESFRSTGQPWQPDKMPQLITLYHRLKRQTEQRVSFLEDTTSAYQE
HEKMYLQLEKQLEAVRMEQSKVNEETLPAEEKLKVYHSLAGSLQNSGILLKRVTRHLEDL
ISHLDPAAYEKAKHQLQAWQEELKLLTSAIGATVTECESRMVQSRDLQTELSRSLEWLRS
VEAALSGPLCLDPNLRDIQEEIRKVQIHQEEVQSSLRIMNALSNKEKEKFTRAKELISAD
LQRTLAELSELDGALQEALRTRQTTLTQIYSQCQRFYQVFQAANDWLEDAHEMLQLTGNG
LDVESAEESLKSHMEFFSAEDQFHSNLEELQGLVANLDPLIKPTGKEDLAQKMASLEEKS
QTIMQDSHAQLELLQRCAAQWQDYQKAREEVIELMNEAEKKLSEFSLLKTSSSHEAEEKW
SEHKALVSVINSFHEKIVALEGEASELERTGNDASKAAISRSTTAVWQRWTRLRAVAQDQ
EKLLEDAVDEWTSFNNKVKKASEVIDQLQDKLPGSSAEKASKAELVTLLEYHDTFILELE
RQQLALGMLRQQALSMLQDGVTPSPGGEPPTVQEITAMQDRCLNMQEKVKKNGKIVKQEL
KEREVVETHISSVKSWVQETKEYLGNPTIEIDAQLEELKILLTEAINHQQNVEKMAEEQK
NKYLGLYTILPSELSLQLAEVALDLGTTHDQIQDKVKEVEQSKAMSQEFSQQIQKIARDL
TTILTKLRAKTDNLVQAKTDQKVLGEELDGCHLKLMELDKAVQKFSEQNGQLGKPLAKKI
GKLTELHQQTIRQAENQLSKLNQAASHLEEYNEILELILRWIEKTKILVHGKIAWNSASQ
LREQYISHQTMLEESEDIHNDLEAMTEKLQYLDSVYHTETMSQQVADLGRETEELRQVIK
IRLQSLHDAAKDMKKFEAELRNLQVALEQAQTTLTSPEVGRLSLKEQLSHRQHLLSEMES
LKPKVHAVQVRQSALRIPEDVVASLPLCHAALHLQEEASRLQHTAIQQCNIMQEAVVQYE
QYEQEMQHLQELIEGAHREIEDKPVATSNIQELQAQISRHEELAQKIKGYQEQIASLNSK
CKMLTMKAKHATMLLTVTEVEGLAEGTEDLDGELLPATSAHPSVVMMTAGRCHTLLSPVT
EESGEEGTNSEISSPPACRSPSPVANTDASVNQDIAYYQALSPERLQTDAAKVPPSTLPP
QELYEPGLEPSATAKLDDLQRSWETLKNVISEKQRTLYEALERQQKYQDSLQSISTKMEA
IEMKLSESLEQGRSPESQMAEHQALMDEILMLQEEISELQSALADELVSESPESEPAEQL
ALQSTLTVLAERMSTIKMKASGKRQLLEEKLNDQLEEQRQEQALNRYRCEADQLDHWLLS
TKATLDIALGSPKEPMDMEAQLVDCQNMLVEIEQKVVALSELSVHNENLLLEGKAHTKDE
AEQLAVKLRTLKGSLLELQRALQDRQLHIQGTAQEKEESDADLAATQSPGVQEWLAQARS
AWTHQRQSSLQQQKQELEQELAEQKSLLQSVASLGEEILTQHSAAETSGGVGEKPDVLSQ
ELGMEGEKSPAEDQMRMKWESLHQEFSTKQKLLQNVLEQEQEQMLYSRPNRLLSGVPLYK
GDGQAQDKSAVTSLLDGLNQVFEEVSSQGGGTKKQNIDLEQKLYDGVSATSTWLDDVEER
LFVATALLPEETETCIFNQETLAKDIKEMSEEMDKNKNLFSQAFPENGDNRDVIEDTLGC
LLGRLSLLDSVVNQRCHQMKERLQQILNFQNDLKVLVTSLADHKYIILQKLAKMFEQPVA
EQIEAIQQAEDGLKELDAGIIELKRRADKLQIEQPSMQELSKLQDMYDELMMTIGSRRSG
LNQNLALKSQYERALQDLADLLETGREKTAGDQKIIVSSKEEIQQLLDKHKEYFQGLESH
MILTETLFRKIISFAVPRETQFHTDLMAQASAVLKGAHKRGVELEYILETWSQLEKEHWE
LSRQLEVVESSTPSVGLVEESEDRLIDRIALYQHLKSSLNEYQPKLYQVIDDGKRLLISV
SCSDLESQLNQLGEHWLSDTNKVSKELHRLETILKHWTRYQSESADLIHWLQSAKDRLEF
WTQQSVTVPQELEMVRDHLNGFLEFSKEVDAKSTLKSSVLSTGNQLLRLKKVDTAALRSE
LSHIDGQWNDLLTNIPAVQEKLHQLQMDKLPSRHAISEVMTWISLMESVIQKDEENIKNS
IGYKTIHEYLQKYKGFQIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAERLGAMN
KSWQILQGLVTEKIQLLEGLLESWSEYENNVQCLKTWFETQEKRLKQQHRIGDQASVQNA
MKDCQDLEDLIKAKEKEVEKIEQNGLALVQNKKEEVSGIVRSTLQELNQTWANLDHMVGQ
LKILLKSVLDQWSHHKVAFDEINSCLMESRYSLSRFCLLTGSLEAVQVQVDNLQNLQDDL
EKQEKSLQKFGSVTNQLLKECHPPVTETLTNTLKEVNMRWNNLLEEIAEQLRASKALLQL
WQRYKDYFKQCAATVQQQEGRTNEFLKAATDKDIGDDEVATWIQDCNDLLKGLGPIQDSL
VVLHELGGQLKQQVDASAASAIQSDWLSLRQQLHALEQALCKQQTVLQETKAGVLDYETF
TKSLEALETWIVEAEEILQGQDPSHSSDLSTIQERMEELKGQMLKFSSMVPDLDRLNELG
YRLPLNDKEIKRMQNLNRRWSLISSQTTERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQ
KLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIFDGQHLLEQGQVDDRDEFNLKL
TLLSNQWQGVIRRAQQRRGVIDSQIHQWQRYREMAEKLRKWLVEVSCLPVSGLGTVQIPL
QQARALFDQVQFKEKVFLRQQGSYILTVEAGKQLLLSADSGAEATLQAQLAEIQEKWKSA
SVCLEEQKKKLAGLLQDWEKCENGIADSLEKLRTFKKRLSQPLPDHHEELHAEQMCCKEL
ENTVGSWTDDLAQLTLLKKALCAYISADDISILNERMELLQRQWEELCHQLSLRRQQVSE
RLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEEMIEKLRKDYQEEIAIAQENKIQLQ
QMGERLARASHESKASEIEYKLGKINDRWQHLLDLMAARVKKLKETLVAVQQLDKNMSSL
RTWLAHIESELAKPIVYDSCDSEEIQKKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDC
DACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDFSHFEDWLKI
SERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDAAGS
LKQTVHKGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHF
SECDVQAKIKQLKAFQQEISLNHNKIEQIIAQGEQLIEKSEPLDAAVIEEELDELRRYCQ
EVFGRVERYHKKLIRLPLPDDEHDLSDRELELDEAGTLSDLHWRDTSTDGVLSPQPSSNP
SLSLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAVSRTLPSEDEEGPEDKDFY
LRGAVGLSGDPGALESQIQQLGKALDDSRFQMQQTENIIHSKTPTGPELDSGYRGYMKLL
GECSGSIDSVKRLEHKLTEEEDHFPGFVNLNSTETQTAGVIDRWELIQAEALSKELRMKQ
KPQRRQQLDSDLNSVLTWLRETEGDLEQLQRLQLSTDIQSIALQIQKLKELQKAVDQRKA
IILSIHLCSSEFTQPGREESQDLQDRLSQMNGRWERVCSLLEEWRGLLQDALMQCQDFHE
MSHGLLLMLENIDRRKNEIVPIDSNLDAEILQDHHKQLKQIRHELLESQLKVASLQDMSC
QLLVNAEGTDCLEAKEKVHVIGNRLKLLLKEVSRHIKELEKLLDMSSSQQDLSSWSSADE
LDTSGSVSPTSGRSTPNRQKTPRGKCSLSQPGPSVNSPHSRSIRGGSDSSLSEPRPARSG
RAFLFRVLRAALPLQLLLLLLIGLACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences F1MGT1
ENSBTAP00000051281 ENSBTAP00000012328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]