SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051389 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051389
Domain Number 1 Region: 41-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-39
Family SCAN domain 0.0000391
Further Details:      
 
Domain Number 2 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 304-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 388-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 217-246
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000102
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051389   Gene: ENSBTAG00000037566   Transcript: ENSBTAT00000057301
Sequence length 460
Comment pep:known chromosome:UMD3.1:25:3833612:3840398:-1 gene:ENSBTAG00000037566 transcript:ENSBTAT00000057301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSPGPQPLAPLEQDEGDILVVKVEDDCCWEEEPSLEAEDPSPETFRQLFRLFCYQEVA
GPREALSRLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEEAV
VLVEGLQREPRKQRPRDPELLPNDALSHGTEEWFSKHQVEAQPEELSLGEGAQHSSQPPL
AQLSHRPRGGPSLWPNRGPAASQHQETAALATSFLSAWSQVPVTLEDVAVYLSQEEWGCL
DLAQQDHRAPPEERGRRLEDGEDSGEDASLSTAWAQALPDLGPGPGQARPQRPQDRVGLL
GVRKPHTCPECGKAFRKTSHLTKHQRTHTGERPYQCQVCGKRFGDRSNCSTHQRVHTGEK
PYACAECGKRFSQSSSLVIHRRTHTGERPYQCQLCGKRFNNSSHFSAHRRTHTGEKPHTC
PACGRGFRRGTDLRKHQRTHGGEQPPRRPPGLQDTPGAWA
Download sequence
Identical sequences F1MUM4
ENSBTAP00000051389 ENSBTAP00000051389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]