SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051447 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051447
Domain Number 1 Region: 282-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-19
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 2 Region: 246-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-17
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 323-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 1-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00000101
Family SCAN domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051447   Gene: ENSBTAG00000046087   Transcript: ENSBTAT00000056913
Sequence length 381
Comment pep:known chromosome:UMD3.1:18:63759771:63762510:-1 gene:ENSBTAG00000046087 transcript:ENSBTAT00000056913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLVLEQFVMCMPPDIQVLVKSSGAETCKDLEEVLRKKQKLTKWAVVRVQGEDFLMPV
SGVEMLESEVSERHGEGDGAMEPQSTVSVVPSDEGQQESQDGQHLSGAKDLLRVQLQKAL
PPETIPETGELEGQTPSKENLQKDVLEDTGVTRTLSSQEPELLQDREGDVSTPSGSRRGP
LKNRRHVKRKRDSTPTCKDVGKEAATCLDQGEFSGQLGSRSVGAFGNVGPTILPEGAETP
GRARSECKVCKKSFPYQSQLTLHQRRHTGERPFKCDICAKGFIQPSDLRVHQRIHTGEKP
YSCDICLKKFTHNSTMHAHKVTHTQEKPFRCEHCDRAFGYRANLSVHQRTHSGLKPYVCP
ECHRAFSQLGSFKRHRKIHSR
Download sequence
Identical sequences G5E6E6
ENSBTAP00000051447 ENSBTAP00000051447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]