SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051553 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051553
Domain Number 1 Region: 16-131
Classification Level Classification E-value
Superfamily POZ domain 4.32e-30
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 404-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000022
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 383-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000129
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051553   Gene: ENSBTAG00000039343   Transcript: ENSBTAT00000052718
Sequence length 510
Comment pep:known chromosome:UMD3.1:11:97651078:97652610:1 gene:ENSBTAG00000039343 transcript:ENSBTAT00000052718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLRFMSVEMDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAA
SSPYFRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQMQ
CVIDKCTQILESIHSKISVGDVDSVTVGAEETPESRNGVKDSSFFANPVEISPPYCSQVR
QPTTSSDLRMETTPSKALRSSRLQEEGHSDRGSSGSVSEYEIQIEGDHEQGDLLGRESQI
TEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYCQAASQ
PAGGVSEAFGSLSNSSPSRSMLSCFRGGRARQKRALSVHLHSDLQGLVQGSDSEAVVSNP
GFESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYT
RKDQLEYHIRGHTDDKPFRCEICGKCFPFQGTLNQHLRKNHPGVAEVRSRMESPERTDVY
AEQKLENDASASEMALDSRMEIHTVSDAPD
Download sequence
Identical sequences F1MIV1
ENSBTAP00000051553 ENSBTAP00000051553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]