SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051638 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051638
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily EF-hand 0.0000000787
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051638   Gene: ENSBTAG00000006568   Transcript: ENSBTAT00000053224
Sequence length 260
Comment pep:known chromosome:UMD3.1:X:60197183:60213594:-1 gene:ENSBTAG00000006568 transcript:ENSBTAT00000053224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTEKLKLLFKLHISPAYTEVQYKDPSK
GDELSKEELLYFSQLHVSKPAKEKEAKSARNSPEKEKEKVNIQAYLSQWQDELLKKEENI
KDLPRMNQSQFIQFSKTLYNLFHGDPEEESLYQAIAVVTSLLLRMEEVGRKLHSPTSAMK
GLSGAAVCVSGVPSEGQAEKPLEKEPSSPREEPQWSFAFEQILASLLNEPALVKFFEKSI
DLKAKLENAKTSQLSCRTKK
Download sequence
Identical sequences F1MI10
ENSBTAP00000051638 ENSBTAP00000051638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]