SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051647 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051647
Domain Number 1 Region: 188-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-25
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 3 Region: 132-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 482-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 347-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000219
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 103-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000984
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051647   Gene: ENSBTAG00000038702   Transcript: ENSBTAT00000052961
Sequence length 543
Comment pep:known chromosome:UMD3.1:18:60545413:60644435:-1 gene:ENSBTAG00000038702 transcript:ENSBTAT00000052961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSEGRLTFQDVAIDFTQEEWECLDPGQRKLYRDVMVENYRNLASLDLWCEAGHQHRLS
EEPTKSTATKATPAMNERALGCRFRCSVRTEVTKLGNPQEENKCKICEKVFSKSSNLSRH
RRIHTGRKPFKSFNCHSLLTQHQRIHAGEKPYICKDCNKAFRRSSFLTQHQRIHTGEKPY
KCTVCGKAFTYNSSLIKHQRIHAGEKPYKCTECSKAFTYNSLLIQHQQIHTGEKPYKCTE
CGKAFTYNSRLIEHQQIHAGEKPYKCTECSKAFIYNSLLIKHRRIHSGEKPYKCTECSKA
FTYNSSLIQHRRIHTGEKPYKCTECSKAFIYNSLLIQHQRIHTGEKPYKCTECSKAFTYN
SSLIQHRRIHSGEKPHKCTECSKAFTYNSLLIQHRRIHTGEKPYKCTECSKAFTCNSALI
EHQQIHTGEKPYKCTECSKAFTYNSCLTEHQRIHTGEKPYKCTECSKAFTCNSDRIEHQR
IHTGEKLYICKECNKAFRRSSFLTRHQLIHTGEKPYKCTECSKAFICYSDLTHHQRIHTG
EKP
Download sequence
Identical sequences G5E6F1
ENSBTAP00000051647 ENSBTAP00000051647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]