SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051700 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051700
Domain Number 1 Region: 2-306
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 9.15e-79
Family Rhodopsin-like 0.0072
Further Details:      
 
Domain Number 2 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-25
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 3 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 482-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 347-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000219
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051700   Gene: ENSBTAG00000037603   Transcript: ENSBTAT00000052569
Sequence length 316
Comment pep:known chromosome:UMD3.1:15:46603202:46604152:1 gene:ENSBTAG00000037603 transcript:ENSBTAT00000052569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KENITYISEFVLVGFPTYPWLQVLLFFLFLITYLFVLLENVVIILTIWVTGSLHKPMYYF
LGTMSFLETWYISVTVPKMLAGFLLCPNTISFLGCMTQLYFFMSLACTECVLLAAMAYDR
YVAICWPLHYPVMMTTEFCVQLTISSWLSGFTVSLAKVYFISQVSFCGNNILNHFFCDVS
PLLKLACMDSSMAEMVDFVLAIIILVFPLSATVLSYAFIVSAILHIPSATGQRKAFSTCA
SHLMVVVIFYTAVIFMYVRPRAIASFNSNKLISAIYAVFTPMLNPIIYCLRNKEVKNAIR
KTMASGRTLFLRDSLC
Download sequence
Identical sequences G5E6F4
ENSBTAP00000051700 ENSBTAP00000051700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]