SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051731 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051731
Domain Number 1 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.28e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 3-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 234-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 6 Region: 436-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000712
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051731   Gene: ENSBTAG00000038674   Transcript: ENSBTAT00000054535
Sequence length 541
Comment pep:known chromosome:UMD3.1:18:60330959:60344819:1 gene:ENSBTAG00000038674 transcript:ENSBTAT00000054535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSQGLFTFKDVAVEFTQEEWECLDPIQRALYRDVMLETYRNLLSLGSYSATFAVKELS
SPKEDISKGELCHLMTLEKNETYGIKDFDLKEICENMQESESEWGYDARNDKEVLLTHNK
NLSQKEDQDNKSLINFPQSVSVRSNTYEYFTHDKPFIRNLLTMKDNIIIAGHNIKCLDSR
TGARLQAQVAELQRFTTEEKMYGGTQLEKSVSNGSSVSSLHQIPPSVETTVLSAQHRKTH
TREKSYNCNDCGKAFSKKSNLTNHKRIHSGQKPYRCSDCGKAFNHQSHLIAHQRVHAEEK
AYKCGVCGKVFSRNSHLANHQRMHTGEKPYKCNECGKAFTQFSHLSRHQKMHAGEKPHKC
NECGKHFTQRSNLMAHQRIHTGEKPFKCNKCDKAFIERSQLWGHERTHTGEKLYKCDECG
KALTRHSYLTQHKTIHTGEKPYKCNECGKAYTQFASLTRHLKIHTENKHMPHTYGNAFIQ
SSKLKQFRQNFCMYSSLTQLMGLYQGGKTHTDAQQTHEKMLSIINHQGNAKHKVNEIPHY
S
Download sequence
Identical sequences F1MJH3
XP_010832655.1.44457 XP_010832666.1.44457 XP_010832676.1.44457 ENSBTAP00000051731 ENSBTAP00000051731 9913.ENSBTAP00000051731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]