SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051748 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051748
Domain Number 1 Region: 15-104
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-36
Family SCAN domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000313
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 452-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000108
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 573-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000145
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 219-249
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000484
Family KRAB domain (Kruppel-associated box) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051748   Gene: ENSBTAG00000038284   Transcript: ENSBTAT00000057172
Sequence length 631
Comment pep:known chromosome:UMD3.1:7:41934348:41975651:-1 gene:ENSBTAG00000038284 transcript:ENSBTAT00000057172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAPESWLQRKGELPNPESSRRLFRRFCYQEAAGPREALHRLWDLCRGWLRPERHTKEQIL
ELLVLEQFLAILPREVQGWVRAQEPESGDQAVSAVEALEREPGRPWQWINNTLNVQVIDH
WEEFPSHLPLFAESFASQKCRQELVRGEKSHENIAEALDSPGLHEVESLILIRDPLHFYK
PSWLICSLPNTQNSSVSVSMGSLGPVSLGIIRNLSQNRVSPFKDMIFCFSEEDWSLLDPA
QTGFYGEFIIGEDCGVSLPPNDAAAQLDLSQGEENEPRVPELQDFQVPAVPPGLLSLGTL
SWHRADQYSTRHPHLEQAARASETVLRESPGLLLDHSLTSLKMPFPGSAAAVGKMNFSFS
SLERLSKSPAIPGRTHNFPICTPLFPHNPYLFRHLNSHCTQSPHTCALISGDEDSQLGPY
CTDEPRSPTEKQHSLPISHRSGIEAAGEVQTSSKKSYVCPNCGKIFRWRVNFIRHLRSRR
EQEKPHECSVCGELFSDSEDLDGHLETHEVQKPFRCGACGKSFRLNSHLLSHRRIHLQPD
GLELVKKKEQEASGTTGGDSDDLLTKGKAKLRCQCCDCGKVFQRPEHLARHRSNIHMDKS
QPFQCRYCVKSFSQNSDLLRHQRLHMKRRSK
Download sequence
Identical sequences E1B7Z6
ENSBTAP00000051748 ENSBTAP00000051748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]