SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051951 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051951
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily POZ domain 2.43e-26
Family BTB/POZ domain 0.00062
Further Details:      
 
Domain Number 2 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 277-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051951   Gene: ENSBTAG00000038970   Transcript: ENSBTAT00000053525
Sequence length 448
Comment pep:known chromosome:UMD3.1:24:39250142:39251488:-1 gene:ENSBTAG00000038970 transcript:ENSBTAT00000053525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYF
KKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLD
KLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADPQDDDVEEIGDQDDSPSDDTVEGT
PPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALAF
NDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTA
DRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPF
ACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPS
AMQSETEQLQAAAMAAEAEQQLETIACS
Download sequence
Identical sequences F1MB88 L8IP17
ENSBTAP00000051951 ENSBTAP00000051951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]