SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051952 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051952
Domain Number 1 Region: 154-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 195-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 41-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 98-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000177
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000406
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000017
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051952   Gene: ENSBTAG00000038322   Transcript: ENSBTAT00000054463
Sequence length 310
Comment pep:known chromosome:UMD3.1:18:55369206:55371100:1 gene:ENSBTAG00000038322 transcript:ENSBTAT00000054463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRRFSCAACGKAFKRAWELLSHEVVHTVARPFRCGLCAAAFKRHSDCKSHRLVHSDERP
HGCDACGKRFKRASNLQEHRRIHTGERPFPCQSCPKRFKTPYELHRHEPLHAPSRPFPCP
DCGKAFAAGPALLLHRRQHCVDKPHACGVCGKRFTHSHSLRVHERVHTGDRPFVCPLCAK
AFKQSNALASHRRVHSGERPYRCATCGKAFKQSSYLAIHRRTHTGERPYPCDACGKAFSR
PSLLLQHRRVHSPVRPHACRFCPRHFKDLNYRAVHERLHTGDTPYKCGLCGKGFAHPSNL
LQHQSVHPDG
Download sequence
Identical sequences F1MB86
ENSBTAP00000051952 9913.ENSBTAP00000051952 ENSBTAP00000051952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]