SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051980 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051980
Domain Number 1 Region: 429-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-18
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 3 Region: 467-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000113
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 387-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000325
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 235-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000673
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 345-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000361
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051980   Gene: ENSBTAG00000027328   Transcript: ENSBTAT00000055970
Sequence length 525
Comment pep:known chromosome:UMD3.1:13:75885059:75888899:-1 gene:ENSBTAG00000027328 transcript:ENSBTAT00000055970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLLQGSMFFNDALVDFTQDEWQLLNHAQRLLHKDVMLENYECMVSLGQLPSQSHLVMEV
EIESDIAVNVLRFIIFLEVQRTNNMKEISQENDRYLRQDLFINNRTLTKERNKTFKETLN
MATDPVPSRKISHQGDPFVTNLKSVSQLMISNRRFRGCMFFDIVHEKTHTENKSCENDQK
KKSHRQIEAFIKHQKISALEHLLEYNHYEKAFHRKTAFIQKLKRAHCKCNKLGKSFCEKS
NLIQHQRIHTRGEKIDACNQCGKSFHEKPCLTQHQRTHTTEKPSECNDGSKCEKSFHKLL
KLSQHQKACLGEPKNECGESRRVLNQRAHREKKTYDCNKCGCGNSFPKKTDFTHHQSMYP
GKKPYKCSECGKSFFVKFNLTEHQRTKETYVCHECGKSCLKSALIIHQRIHAGEKPRICN
EGEKTSCVKSNLAQHQRMHIGEKPYKCNECWRSFCVKSNLVVHQRTHTGDRPYKCPECGK
TFYEKSPLTKHQKIHTGEKYECNECRKSSSQRSALTKHQRKTGEE
Download sequence
Identical sequences F1N146
ENSBTAP00000051980 ENSBTAP00000038982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]