SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052171 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052171
Domain Number 1 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-24
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 9 Region: 562-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 147-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.51e-19
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052171   Gene: ENSBTAG00000017651   Transcript: ENSBTAT00000054828
Sequence length 622
Comment pep:known chromosome:UMD3.1:18:58866568:58876003:1 gene:ENSBTAG00000017651 transcript:ENSBTAT00000054828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QERLTCEDVAIEFTHEEWVFLDPAQRALYRDVMLETYRNLLSVGISVSDLNSISTLEQEK
KLWTVGSDVKVAKNTMVCSSRADLENLRQLLIDTFLRVLVEKYSVFESWPLQRIPPCVQT
SVSNIYGNDFMNPSVITQELKAHKENPYKCDECGKAFSHSSHLRRHKKIHTGKKLFKCDI
CGKVFSRNSNLAVHQTVHTDEKPYKCDECGKAFRVKSSLLSHQTVHTGEKPYKCNDCGKA
FRIKSSLLSHQTIHTGEKPYKCDECGKAFRVKSSLLSHKTIHTGEKPYKCDECGKAFHVK
SILLSHQTVHTGEKLYKCDECGKAFRVKSSLLSHQTVHTGEKPYKCNDCGKAFRVKSSLL
SHQTIHTGEKPYKCDECGKAFHVKSILLSHQTVHTGEKLYKCDECGKAFRVKLSLLSHQT
LHTGQKPYKCDECGKAFPVKSTLSKHQAIHTGEKPYKCDECGKAFPVKSTLLRHQTVHSG
EKPYKCDECGKAFPIKSTLSQHQTIHTGEKPYKCDECGKAFRLKSVLLKHQTIHTGQKPY
KCDECGKAFRVKSTVLSHQAVHTGEKPYKCDECGRVFRKKPQLQRHCRIHTGERPFRCNE
CGKFFSQNSHLKRHRRIHIEKP
Download sequence
Identical sequences F1MQU6
ENSBTAP00000052171 ENSBTAP00000052171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]