SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052175 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052175
Domain Number 1 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 258-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 404-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 367-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000593
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000189
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 233-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000141
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 143-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000711
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 111-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000334
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number 9 Region: 66-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000235
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052175   Gene: ENSBTAG00000038241   Transcript: ENSBTAT00000056211
Sequence length 559
Comment pep:known chromosome:UMD3.1:4:113602367:113604046:1 gene:ENSBTAG00000038241 transcript:ENSBTAT00000056211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLERRCRGPVAMGPAQPRLLSGPSQESPQTLEKEPQGLRSRGTAAAQSGGQALGRAHRCA
HCRRHFPGWVALWLHARRCQARLPRPCPECGRRFRHAPFLALHCQVHAAATPDQGFACHL
CGQSFRGWVALVLHLRAHSAAKRPIACPACERRFWRRKQLRAHSRRCHPPAPEARPFICG
NCGRSFAQWDQLVTHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGGDAVDRPFQCAC
CGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPCTECGRR
FRHKPNLLSHSKIHKRSEGSAQGGPQPPASAPERTPEPPPEPAPEPAEVPVGPGQPSAAA
EAPPSLHTCADCGRGFRLERFLRAHQRQHGGERPFACAECGKHFGKKTHLVAHSRVHSGE
RPFACEECGRRFSQGSHLAAHRRDHAPERPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYV
CPECGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAIC
GQTFDDEGKLLAHQKKHDV
Download sequence
Identical sequences Q0VCC5
ENSBTAP00000052175 9913.ENSBTAP00000052175 NP_001068989.1.59421 NP_001068989.1.76553 ENSBTAP00000052175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]