SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052177 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052177
Domain Number 1 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 4-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 3 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 457-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 195-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.08e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052177   Gene: ENSBTAG00000009460   Transcript: ENSBTAT00000012446
Sequence length 597
Comment pep:known chromosome:UMD3.1:18:64908196:64937559:-1 gene:ENSBTAG00000009460 transcript:ENSBTAT00000012446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLTLQVVVTFKDVAVTFTREEWGQLDLGQRTLFREVMLETCGLLVSLGHPIPKPELIHL
LEHGQKLWTGTRGLPHSTSPGDRPKCQPRDSSSSQPVLSEEALLQGSLTLGSSWDSRLGR
AGAPQGLLETRRVPETPEMDAGKEAHPGKVSLEDDGLGAGDGLHLGAFQKSVSRGDVLHE
RDPQRPGKGPPSHHLYKCKQCGKAFNRKWYLVRHQRIHTGMKPYECNACGKAFSQSSTLI
RHYLIHTGEKPFQCGECGKAFKRRSYLRQHQPAHTGEKPYTCSQCRKAFTHRSTFIRHHR
THSGEKPFECKDCEKAFSSRAHLIQHYVIHTGQKPYECAECAKAFRCSSELQQHQRVHTG
EKPYTCAQCGKAFHRSTYLLQHSVIHTPETPFKCAQCGKAFKRRSHLLQHRRVHTGQGHY
RCSKCGKAFRKKYKFTEQWRVHTGEKPYLCSDCGKFFRQSCSLIHHRKVHTGERPYECCD
CGKVFVHKYKLFEHQRTHTGKRPYECNECGKAFARKDSLVQHQKIHTGENPCKCSECGKC
FLYRNNLLAHQRIHPGKNLSCAVNVGKPMSTKEVLLCIREFILWRRHMGVTNVGNCL
Download sequence
Identical sequences F1MQU3
9913.ENSBTAP00000052177 ENSBTAP00000052177 ENSBTAP00000052177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]