SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052233 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052233
Domain Number 1 Region: 648-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 704-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 481-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 760-817
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 369-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.96e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 816-873
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 315-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 12 Region: 212-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 13 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 14 Region: 859-902
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000194
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052233   Gene: ENSBTAG00000011052   Transcript: ENSBTAT00000055688
Sequence length 914
Comment pep:known chromosome:UMD3.1:18:59398666:59423657:-1 gene:ENSBTAG00000011052 transcript:ENSBTAT00000055688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSQERLTSEDVAIEFTQEEWEFLDPAQRALYRDVMLETYRNLLSVDISPTHVIKHLQL
KANSEKLETFQTSMLGRPESCEIKHFHLWESQENMRDFECQGRDDKRNYKGTPVSLNGNM
PDGRDLHDRKDAGIKPFGNRLGFNFQDKLQIFQTGGIISEYDEAKRSVNNSFSFSPLQRI
PPCVQPSVSNIYGNDFINPSVITQELKAHKEKPYKCDECGKTFRVKSILLSHQTVHTGEK
PYKCDECGKAFTDSSHLRRHKKIHTGKKLFKCDICDKVFSRNEHLAGHQRVHSGEKPYKC
DECGKAFTHSSHLSRNEHLAVHQRVHTGEKPYKCDECGKHFSQPSQFTSHKRFHTREKPY
KCDECGKQFSQPSQFISHKRFHTGEKPYKCDECGKAFHVKSILFRHQTIHTGEKPYKCDE
CGKAFTDISNLGRHQKIHTEKKLFKCDICDKVFSRSEHLAGHQRVHTGEKPYKCDECGKH
FSRASQFISHQRVHSGEKPYKCDECGKAFHEKSILLRHQTVHTGEKPYKCDECGKAFRVK
STLLTHQTVHTGEKPYKCDECGKAFSDSSSRRRHQKIHTGKKLFKCDICDKVFSRNEHLA
GHQRVHTGEQPYKCDECGKAFHEKSILLRHQTVHIGEKPYKCNECDKAFRVKSILLRHQT
VHIGEKPYKCDECGKAFRVKSPLLTHQTVHTGEKPYKCDECGKAFHEKSILLRHQTVHTG
EKPYKCDECGKAFHEKSILLRHQTVHTGEKPYKCDECGKAFHEKSILLRHQTVHTGGKPY
KCDECGKAFRVNSILLRHQTVHTGEKPYKCDECGKAFRVKSTLLTHQTVHTGEKPYKCDE
CGNVFSQKAHLQLHWRIHTGERPFRCNECGKFFSQNSHLKRHWRIHIEKPFKYFECGKSF
TQVSALTKHQKIHT
Download sequence
Identical sequences F1N7R8
ENSBTAP00000052233 ENSBTAP00000052233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]