SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052313 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052313
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-40
Family SCAN domain 0.0000517
Further Details:      
 
Domain Number 2 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 373-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052313   Gene: ENSBTAG00000037988   Transcript: ENSBTAT00000057234
Sequence length 435
Comment pep:known chromosome:UMD3.1:23:30115123:30124154:1 gene:ENSBTAG00000037988 transcript:ENSBTAT00000057234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAGEQDGLKIVKVEEDPIWDQEPYLRENNFSGQEASRQLFRHFCYQETPGPREALSRL
RELCHQWLRPDTHTKEQILELLVLEQFLTILPEELQAWVCEHHPESGEEAVAAVEDLERE
LSEPENQAPDCEHGLAEMLSGDAVHLKAKEESTAFQLQSMVMQLKCESFGVHKFGEQDGE
TVLKNQDLTSKQEVLKEMGHFENSRLQRDIPLDSKYRETCKHESREEKQSGQPTGERCHK
CNECGKSFTQSSVLIQHQRIHTGEKPYECEECGKTFSQRSGLIEHQRSHTGEKPYQCKDC
GKAFSASNSLIRHRRIHTGEKPYECEECGKTFRLSSYLVQHQRIHTGEKRYHCNECGKAF
SQNAGLFQHLRIHTGEKPYQCGQCSKSFSRRTLLIKHQRSHTGERPYECDECGKAFSHHC
NLIRHFRIHTVVKLD
Download sequence
Identical sequences Q2HJ70
NP_001039702.1.59421 NP_001039702.1.76553 XP_010816735.1.76553 XP_010816736.1.76553 XP_019840819.1.53367 ENSBTAP00000052313 ENSBTAP00000052313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]