SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052325 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052325
Domain Number 1 Region: 539-568,667-744
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052325   Gene: ENSBTAG00000038381   Transcript: ENSBTAT00000053679
Sequence length 763
Comment pep:known chromosome:UMD3.1:22:51821391:51832167:1 gene:ENSBTAG00000038381 transcript:ENSBTAT00000053679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSEAPGERDTQALLSRTQAMELRRRDYHVERPLLNQEQLEELGSRSPAQVTLQWRTWF
RCSRARAQALLLQYLPVLAWLPQYSVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFVYFLFGTSRHISVGTFAVMSVMVGSVMESLAPDDAFLLGLNSTLDVAAR
DATRVQLASTLSVLVGLFQVGLGMVHFGFVVTYLSEPLVRAYTTAASVHVFVSQLKYVFG
LHLSSRSGPLSLIYTVLEVCWKLPQMVVGTMVTAIVAGVVLVLVKLLNEKLRRHLPMPLP
GELLTLIGATGISYGVGLKQAFGVDIVGKIPTGLVPPMAPRPQLFAKLLGNAFAIAVVGF
AIAISLGKIFALRHGYRVYSNQELVALGLSNLLGGIFQCFPVSCSMSRSLVQESTGGNTQ
VAGAISSLFILIIIVKLGELFQDLPKAVLAAVVIVNLKGMVMQCTDVVSLWKANRMDLLI
WVVTFVATILLNLDLGLAVAVVFSLMLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSGARE
VPGVKVFRSSVTVYFANAELYSDSLKQRCGVDVDYLLSQKKKLLRKQELKLKQLQKENKL
PKQAAASKGTSVSINVNPTVMDIESNNDVEGSKAREASAGTELEDTGAWAPEDAKASDIS
SLKALGLPQPDFHTLILDLSSFSFVDTVCLKSLKNIFRDFREIEVEVYMAACHAPVITQL
EDGHFFDASITKQHLFASVHDAVLFALQHRRSGPVNPVLVTKL
Download sequence
Identical sequences E1BFJ3
ENSBTAP00000052325 XP_019840596.1.53367 ENSBTAP00000052325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]