SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052434 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052434
Domain Number 1 Region: 49-141
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.11e-39
Family SCAN domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 295-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 375-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052434   Gene: ENSBTAG00000037965   Transcript: ENSBTAT00000052461
Sequence length 431
Comment pep:known chromosome:UMD3.1:1:95203732:95206770:1 gene:ENSBTAG00000037965 transcript:ENSBTAT00000052461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQAHSRIATALALQTPEMHEGLLAVKVKEEKGDHTRMGQEPGLSGDNPHTREIFRRRFR
QFCYQETPGPREALRRLQELCHQWLRPEMHTKEQILELLVLEQFLTILPEELQAWVREHR
PVSGEEAVIVLEDLERELDEPREQVPARDHEQKELVKEKAALGTAQESSSSQLQTLEERP
QWNLRGVGPIQEIGSLSHSPNENMVACPLPPTLLTSIFLSLGTQHSCNPFIISDNETGTW
NVELAPKRELSKEKKSLVEAPEKLNGDTIPVPEYGETCDQEGRLERQRGSSSVERPYVCS
DCGKSFTQNSILTEHQRTHTGEKPYECDECGRAFSQRSGLFQHQRLHTGEKRYQCSVCGK
AFSQNAGLFHHLRIHTGEKPYQCNQCSKSFSRRSVLIKHQRIHTGERPYKCDKCGKNFIY
HCNLIQHRKVH
Download sequence
Identical sequences E1BBS4
ENSBTAP00000052434 ENSBTAP00000052434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]