SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052512 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052512
Domain Number 1 Region: 282-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-18
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 244-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.56e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 323-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000706
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 1-38
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000016
Family SCAN domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052512   Gene: ENSBTAG00000038022   Transcript: ENSBTAT00000052986
Sequence length 380
Comment pep:known chromosome:UMD3.1:18:63833941:63836659:1 gene:ENSBTAG00000038022 transcript:ENSBTAT00000052986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLVPEQFVKCMPPDIQVLVKSSGAETCKDLEEVLRKKQKLKKRAVVRVQGEDFLMPV
SGVQMLGSEINEGHSEGDRARKPQSTVSVVPPDEGQQESQDRQHLPGAKNLSRGQGQKAL
PPETIPETGELEGQTPSKENLEKDLLKDTGVTRTLPSQEPELLQDREGDVSTLSGSRRGP
LKNRRHVKRKRDSSPSCQDMGQEAATCLDQGEFSEQLGSRSVGSSGSVGPTSLPEGAETP
GRAPSECKVCKKSFPYQSQLTLHQRTHTGERPFQCDICARGFMQLLDLQVHQRIHTGKKP
YSCDICLKKFTHDFTLRAHKRTHTQEKAFRCEHCDRAFGHRGNLKVHRRTHYRIKPYVCP
ESQAFCQLGTLKRHQKIHSK
Download sequence
Identical sequences E1BAK8
ENSBTAP00000052512 9913.ENSBTAP00000052512 ENSBTAP00000052512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]