SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052646 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052646
Domain Number 1 Region: 135-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.75e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-22
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 191-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 93-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 289-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000052646
Domain Number - Region: 54-81
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.079
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052646   Gene: ENSBTAG00000039341   Transcript: ENSBTAT00000052295
Sequence length 350
Comment pep:known chromosome:UMD3.1:18:64743056:64744108:-1 gene:ENSBTAG00000039341 transcript:ENSBTAT00000052295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNLALEGGLCGPEVLRTNPGQTLCGTDVKSHQHGGEKLMRRDWGKALMKNCTVHALEKA
FMCQEARKDFPGTSDHVQHQVKPQMMEFVAEFHNGEKRFKCSECGKLFYRKSRLAQHHRV
HTGEKPYECSECGKVFRCSSSLAIHRRIHTGERPYECRECGKFFRQHSQLVVHQRIHTGA
RPYECSECGKTFSTKTKLDQHWRVHTRERPYECEECGRTYNCKRMLDQHQRVHTGEWPYE
CSECGKAFRYFSSLFMHRRIHSGERPYECSECGKSFRQKAHLQGHQRIHSGAKTFECSEC
GRCFSQKSVLTKHQRVHTEERPYMCSECGKCFRDRTSLIKHLNLHWRKAT
Download sequence
Identical sequences E1B8F8
9913.ENSBTAP00000052646 ENSBTAP00000052646 ENSBTAP00000052646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]