SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052670 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052670
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 338-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-16
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 199-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000048
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 274-297,324-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000578
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052670   Gene: ENSBTAG00000011664   Transcript: ENSBTAT00000055229
Sequence length 389
Comment pep:known chromosome:UMD3.1:18:64175124:64177906:1 gene:ENSBTAG00000011664 transcript:ENSBTAT00000055229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELVTFEDVAVHFSPEELPYLSASQRNLYREVMLENYRNLVSLGYQFPKPDIISQLEEEE
SHAREEDGSTVTCQDWEEQSETKDLTPEQSLPVEKSTSGAGIEDLEAGDSWYTHTGESSD
DPLESQQVKPAEVLSPTEMSDPKTLNQEGSHEGDQLEKSLELNKPLESLPGKDPQERTTP
EVCTRSQLAHNLFFLQENKHYRCEFFDRNFSTRPGREKHQQIHTGKKPFVCKQCGEAFYL
MLHLTRHQKTHSDGKSLTQRADVYGRVRIQSQDYHECFQCGKAFIQAVHLFQHLKAHEVA
MALPLELPRNKMYLIRYKRQHDYIGERAYQCCDCGRRFRQSSHLIQHYRIHAQERPYQCQ
LCGKCFSQPSYLTQHYQLHSQEKPLECRH
Download sequence
Identical sequences F1N2R2
ENSBTAP00000052670 ENSBTAP00000052670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]