SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052950 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052950
Domain Number 1 Region: 5-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-26
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 449-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.8e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 561-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 505-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 602-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 9 Region: 644-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000239
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 355-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000256
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052950   Gene: ENSBTAG00000039782   Transcript: ENSBTAT00000053303
Sequence length 696
Comment pep:known chromosome:UMD3.1:25:39051002:39055715:-1 gene:ENSBTAG00000039782 transcript:ENSBTAT00000053303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVPTMVPLQGSVSFRDVAVDFTQEEWQHLDPEQKTTYRDVMLENYSHLISVGCHIIKPEV
ITKLEQGEEPWVVEGEFLLQSHPEEVWKVHDLMEGSQENEDKHSRQTESINNKTLPEGRG
NGLGKTCNVETSPVSSRKISYQCDSCEKSLKSISEYISSDGSYARMKPDECSACGRSLLH
VKLEKIHLGDKPYEFNQNREAYALNEESIYQNIHILEKPFEYIECQKAFQKDTVFVNHIE
EKPYKWNESEIAFLQMSNLSVHPTTHLEMKPYECNACGKSFCKKSKFIIHQRTHTGEKPY
ECNQCGKSFCQKGTLTVHQRTHTGEKPYECTECGKTFYQKLHLIQHQRTHSGEKPYECSY
CGKAFCQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCNECGKC
FCRKSTLTTHQRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNECGKTFYLN
SALMRHQRVHTGEKPYECNECGKLFSQLSYLTIHHRTHSGVKPYECNECGKTFYQNSALC
RHRRIHKGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYECNECGKTFCQNSALNRHQR
THTGEKAYECYECGKFFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSG
EKPYECTECGKKFYHKSAFNSHQRIHRRGNMNVLDV
Download sequence
Identical sequences F6QFC2
ENSBTAP00000052950 ENSBTAP00000052950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]