SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053085 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053085
Domain Number 1 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.77e-27
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 617-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 561-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.03e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 133-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-23
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 7 Region: 730-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.86e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 9-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 10 Region: 673-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.28e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 271-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 12 Region: 187-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-20
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 13 Region: 776-828
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 14 Region: 97-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-16
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 15 Region: 236-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000225
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 16 Region: 412-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000902
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053085   Gene: ENSBTAG00000038755   Transcript: ENSBTAT00000056450
Sequence length 833
Comment pep:known chromosome:UMD3.1:18:60952727:60988020:-1 gene:ENSBTAG00000038755 transcript:ENSBTAT00000056450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTATWHLYFVFQGWLTFQDVAIDFTQEEWECLDLGQRKLYRDVMLQNYRNLASLGRFCGL
NIRRVETTAIYTGTCEYMGPMTQVRGPRISENPQKENKCRICGKVFSKSSNLSKHWKIHT
GRKPFKCTDCSKAFNCRSRLTQHQRIHTGEKPYKCIECGKAFIYNSSLIQHQRIHTGEKP
YKCTECKKPYKCTECGKAFNRNSTLSQHQRIHTGEKPYKCKDCGKAFIRCSYLTEHQRIH
TGEKPYKCKDCDKAFIRCSRLTEHQRIHTRKRYKCKECGKTFITSSYLTKHQQIHTGERP
YKCTECGKAFNRNSNLTQHQRIHTGEKPYKCTECGKAFNQNSSLTQHQRMHTGEKPYKCK
ECGKAFNHNSILTQHQRIHTGERPYHCTECGQTFIRSSTLTAHHRIHTGEKPYKCTECGK
AFYTNSDLSKHHRIHMGDKRYKCTECDKAFINSSSLTKHQQIHPGERPYKCTECGKAFNQ
NSILTTHLKIHTGRKPFKCTDCSKAFNRRSHLTQHQRIHTGEKPYKCTECGKAFPYSSSL
TEHQRIHTGERPYKCTECSVAFVCSSHLTYHQRIHTGEKPYKCKECNKAFLSRSLLTQHQ
RVHSGERPYKCKECNKAFIRRSHLTKHQRIHTGERPYKCKECNKSFSQYSNLAYHQRIHT
GERPYKCKECKKTFIHRSHLTQHQGIHTGERPYKCKDCNKAFIQKRSRLTKHQRIHTGEK
PYSCVECGKAFTCNSTLTEHWRIHTGERPHKCKDCNKAFHRRSLLTQHQRVHTGERPYKC
TECGKAFGRYSTLSTHQRIHTGERPYKCTACGKAFSRSDHLSKHLRTHTRQKR
Download sequence
Identical sequences F1MP77
ENSBTAP00000053085 ENSBTAP00000053085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]