SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053164 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053164
Domain Number 1 Region: 578-656,782-841
Classification Level Classification E-value
Superfamily EF-hand 3.11e-20
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053164   Gene: ENSBTAG00000013806   Transcript: ENSBTAT00000061194
Sequence length 858
Comment pep:known chromosome:UMD3.1:1:44647591:44712979:-1 gene:ENSBTAG00000013806 transcript:ENSBTAT00000061194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSFLRVPSPKGLEPSKGPVQLTPQRKSPLSMEVGLAPEGKDDLEERRVFMGTTSPTELG
LRVGLRKDFPCSKTYEERMASPEIRSPSSKGLELRLKRQNISRTVMDGSNLGVHRVSASQ
ETKPPLSALPGRVGLEKERFLAGYCPGRVTQPPLGQGCESPQASGGRRCPVTGDPEGFGA
SVSKLPALGMECRGELGGESACVVMKPRAETEPPVEVDMGLTRLEEPAEMESPEPQMGLV
MEPPAWQLAQQPEEQREAENTEPGVEPPDRIRPIYSGKFFDRMPCWPSAGKVLPIGYRAA
TCLTERFPRLMTPPEAKKFFNFRYPPAGAERVFYGRANDPQIAPSLTHGIRSKISIPAKV
LINPQPITTFQQKMKDKKESVYFSNQRAPLGKSHDQTPGLPKGLDILNTTFGTAIVRETS
ARDMVNPPKPYKEVFEEAQAGHDLYVVSHNDYFVGEAKNRKYDPSSFHRFNLYGIPTPHF
NDGRNMAKTLHWLHELQMKRGAKIVSKRVDDFKEKFQHRLGRVLDPIAETMNVPPDYTFG
AFLRPEDYGVGDLIHRRLPGEYLRGKDRQRGLVAAVRHHLKKVNYQNFDTLLAAFRHYDK
KGDGVIDRAELQEACDQACLHLDEKLLDQLFEYCDVDKDGLINYLEFANFLTWKDKTPLK
EYEEKVLIKGRKADCANPAEANVEESEPALLLKPEDIVLKEPGSSEKTLRTLLRPSDKVS
NHYKTTSSEISAVVGAVPSTCYPTYGVPTIRSDIPAPLIRRVSDRTSYGEEGNAYSLLHP
TIFAQKGVFERDFFKTRSKQEISEILCNIGVKLSEDEFENVWNLASKKHHRGEVCVENIR
SVLDELQHADGAKCKAAT
Download sequence
Identical sequences F1MMV1
ENSBTAP00000053164 ENSBTAP00000053164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]