SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053229 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053229
Domain Number 1 Region: 142-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000101
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 1173-1222
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000514
Family Myb/SANT domain 0.0037
Further Details:      
 
Domain Number 3 Region: 177-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000111
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053229   Gene: ENSBTAG00000012606   Transcript: ENSBTAT00000061246
Sequence length 1363
Comment pep:known chromosome:UMD3.1:18:54934641:54949833:-1 gene:ENSBTAG00000012606 transcript:ENSBTAT00000061246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQYSLGDEGALPSEMHLPSFPENQALTCSDAINRDLGPGSRDLLYGGLRGLELDPSFPA
PDAPSEPLEDNLDTLSLYSGKDSDSTKLLEECVDPESQASLQDLGQGALKVPKEADEGGR
ATSGSARKGKRQHSSPQNTLLDCSLCGKVFSSASSLSKHYLTHSQERKHVCKICSKAFKR
QDHLTGHMLTHQKTKPFVCIEQGCSKSYCDYRSLRRHYEVQHGLCILKEVPPEEEACGDS
PHMHEVAGQPTPSGLRSPGSLLPNRDFLRCLVNSIVHHKIPSPGPAGLADSGEGRNMACS
CPSSGSSCCGPAGTPGTLGPDVLEESRPSRKEPAADVFTAIHSRAAESSGPDPAELEPLQ
LSSSLEGWPEGAPLPSCLPLFRGQTIPTTGSQPSSHSFQWLQNLSGCPKSKGNGMFVVHK
PPSQEASEPGPGLSSTSLVGEPSAGLGLGPEDVPPFPPMLLKAPGEASGDPRFACASGDD
DCWAPKKSKFDCDSFRWPKPGDPGSQDPGLKPSSLSSDATPLFRQLFLKSQESLVSHEQM
QVFQMITKSQRIFSHAQVATASSQLPTPDGKQGPLKPLQGPRPQQPPSLTPTVDSLRAGP
MNPEPEGSPARRRKSTPTFPREASPGGMSRDAKGGPKVAAAPPALTASSLDPPGNPDISS
LAKQLRSSKGTLDLGDIFSPGGLRQTQLGGDEPSGTHLPGKQTQAENGMASGATKAEKGP
ACSRGGGYRLFSGNSRAQRFSGVRKEKVKMDMCCAASPSQVAMASFSSAGPPADLSRDSK
SKLTIFNRIQGGNIYRLPHPMKEENVASGCHQHNRGSTDWAEPRSTYICKNCSQMFYTEK
GLNSHMCFHSDQWPSPRGKQDPQVFGMEFCKPSRQVLRPEGDGQSPLGARKCLDNPTAAS
LGVPVAPANRPPGSKAWWPCPAASAEGCGHVLVQGQEKDGDERNSKEDGQHRKRKKRPQP
KALFVPPPPPTFGQPGPGGCHQSRLRSPVFLVDRLLKGLFQCSPYTPPPMLSPIREGSGL
YFNTLCSTSAQASPDRLISTVLNPLDDSFGICLVKDDTKISIEPHINIGSRFQAEIPELQ
DSSLAGIDEHVASLVWKPWGDVMSNPETQDRVTELCNVACSSVMPGGGTNLELALHCLHE
AQGDIQVALETLLLRGPQKPRTHPLASYRYTGSDIWTPMEKRLFKKAFCAHKKDFNLIHK
TIQTKTVAQCVEYYYIWKKMIKFDCGRAPGPEKRVRREPDEVDRAEAKVTCSPRERPSHR
PTPELKIKTKSYRRESILNSSPSTGPKRSPEAPGSVEGQGAFPCRECERVFDKIKSRNAH
MKRHRLQDHVEPIVRVKWPVKPFQLKEEEEEEELGADMGPLQW
Download sequence
Identical sequences F1MLU0
ENSBTAP00000053229 ENSBTAP00000053229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]