SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053369 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053369
Domain Number 1 Region: 2177-2251
Classification Level Classification E-value
Superfamily Homeodomain-like 8.13e-19
Family Homeodomain 0.0044
Further Details:      
 
Domain Number 2 Region: 2559-2629
Classification Level Classification E-value
Superfamily Homeodomain-like 1.24e-18
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 3 Region: 2884-2953
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-18
Family Homeodomain 0.0041
Further Details:      
 
Domain Number 4 Region: 2098-2167
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-16
Family Homeodomain 0.011
Further Details:      
 
Domain Number 5 Region: 2970-3014
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000841
Family HkH motif-containing C2H2 finger 0.00045
Further Details:      
 
Domain Number 6 Region: 1504-1578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000133
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 1362-1409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000599
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 8 Region: 688-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000425
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 740-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000194
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 1915-1937,2275-2300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000512
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053369   Gene: ENSBTAG00000033268   Transcript: ENSBTAT00000061595
Sequence length 3586
Comment pep:known chromosome:UMD3.1:14:41988047:42189775:1 gene:ENSBTAG00000033268 transcript:ENSBTAT00000061595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METCDSPPISRQENGQSTSKLCGTAQLDNEVPEKVAGMEPDRANSSTDDNLKTDERKSEV
LLGFSVENAAATQVTSAKEIPCNECATSFPSLQKYMEHHCPNARLPVLKDDNESEISELE
DSDVENLTGEIVYQPDGSAYIIEDSKESGQNAQSGANSKLFSTAMFLDSLASAGEKGDQS
ASAPLSFYPQIINTFHIASSLGKPFTADQAFPNTSALAGVGPVLHSFRVYDLRHKREKDY
LTSDGSAKNSCVSKDVPNNVDLSKFDGCVSDGKRKPVLMCFLCKLSFGYIRSFVTHAVHD
HRMTLNEEEQKLLSNKCVSAIIQGIGKDKEPLISFLEPKKSTSVYPHFSTTNLIGPDPTF
RGLWSAFHVENGDSLPAGFAFLKGSPSTPGSAEQPLGITQMPKAEVTLGGLSSLVVNTPI
TSVSLSHSSSESSKMSESKDQENNCERPKESNALHPNGECPVKSEPTEAGDEDEEDAYSN
ELDDEEVLGELTDSIGNKDFPLLNQSISPLSSSVLKFIEKGPSSSSATVSDDPEKKKQAA
AVRAGGGVSGSYGISGKDLAEASASKEGATATHLSETARGDEDSSAAPHQHGFTPSAPGT
PGPGGDGSPGSGIECPKCDTVLGSSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLE
AHMKEKHPEPGGSCVYCKTGQPHPRLARGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQS
DKHLNNVQNLQNGTGEQVFGHSAPAPNSSLGGCGTPSPSKPKQKPTWRCEVCDYETNVAR
NLRIHMTSEKHMHNMMLLQQNMKQIQHNLHLGLAPAEAELYQYYLAQNIGLTGMKLENPG
DPQLMLNPFQLDPATAAALAPGLGELSPYISDPALKLFQCAVCNKFTSDSLEALSVHVSS
ERSLPEEEWRAVIGDIYQCKLCNYNTQLKANFQLHCKTDKHMQKYQLVAHIKEGGKSNEW
RLKCIAIGNPVHLKCNACDYYTNSVDKLRLHTTNHRHEAALKLYKHLQKQEGTVNPESCY
YYCAVCDYSTKVKLNLVQHVRSVKHQQTEGLRKLQLHQQGLALEEDNLNEIFFVKDCPPN
ELETASLGARTCEDDLTEQQLRATSAEEQNEEAEGAIKPIAGADEDEKDTSERDNSEGKN
SNKDSVSVAGGTQPLLLAKEEDVSTKRSKPTEDNKFCHEQFYQCPYCNYNSRDQSRIQMH
VLSQHSVQPVICCPLCQDVLSNKMHLQLHLTHLHSVSPDCVEKLLMTVPVPDVMMPNSLL
LPAAASEKSERDTPAVITAEGAGKYSGDSPMDDKSMVGLDDSKASVEIKSEEQKPTKEAT
EVLEWNKNSSKDMKISDTLQDQLSEQQKRQPLSVSDRHVYKYRCNHCSLAFKTMQKLQIH
SQYHAIRAATMCNLCQRSFRTFQALKKHLEAGHPELSETELQQLYASLPVNGELWAESEP
MAQEDHALEQEMEREYEVDHEGKASPVGSDSSSIPDDMGSEPKRTLPFRKGPNFTMEKFL
DPSRPYKCTVCKESFTQKNILLVHYNSVSHLHKLKKVLQEASSPVPQETNNSPDNKPYKC
SICNVAYSQSSTLEIHMRSVLHQTKARAAKLEPGSGHGPGGHGVAASVNSPSQGMLDSIS
LAAVGSKDTHLDAKELNKKQTPELISAQPTHHPPQSPAQIQMQLQHELQQQAAFFQPQFL
NPAFLPHFPMTPEALLQFQQPQFLFPFYIPGTEFSLGPDLGLPVGSAAFGMPGMTGMAGS
LLEDLKQQIQSQHHVGQTQLQILQQQAQQYQATQPHVPSQKPQPQPQQQQQPQQQQASKL
LKQEQTTVASADCPIVKDVPSYKEAEEMAEKQDKPKQECVSEGEGLKESKDLGKKPKSSE
PSIPPPRIASGARGNAAKALLENFGFELVIQYNENRQKVQKKGKSGEGESTEKLECGTCG
KLFSNVLILKSHQEHVHGQFFPYGALEKFARQYREAYDKLYPISPSSPETPPPPPPPPPL
PPAPPQPPSLGPVKLPSAVSTPLQAPAPTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVS
LDLPLFPSIMMQSVQHPALPPQLALQLPPMDTLSADLTQLCQQQLGLDPNFLRHSQFKRP
RTRITDDQLKILRAYFDINNSPSEEQIQEMAEKSGLSQKVIKHWFRNTLFKERQRNKDSP
YNFSNPPITVLEDIRMDPQPSSLEHYKSDTSFSKRSSRTRFTDYQLRVLQDFFDTNAYPK
DDEIEQLSTVLNLPTRVIVVWFQNARQKARKSYENQTETKDNEKRELTNERYIRTSNMQY
QCKKCSVVFPRIFDLITHQKKQCYKDEDDDAQDESQTEDSMDATDQVVYKHCTVPGQTEA
AKTAPAPAGGSASGTSTPLIPSPKPEPEKTSPKPEYPTEKPKPGDPSPHTQGTKPALPSA
SSSSDPPPPPPASAVQPQPPKPPQLLGRPPSASQTPVPSSPLQISMTSLQNSLPPQLLQY
QCDQCTVAFPTLELWQEHQHMHFLAAQNQFLHSPFLERPMDMPYMIFDPNNSLMTGQLLG
GPLTQMPPQTASSHPAAPATVAASLKRKLDEKEENNCSEKEGGNSGEDQHRDKRLRTTIT
PEQLEILYEKYLLDSNPTRKMLDHIAREVGLKKRVVQVWFQNTRARERKGQFRAVGPAQS
HKRCPFCRALFKAKSALESHIRSRHWNEGKQAGYSLPPSPLISAEDGGDSPQKYIYFDYP
SLPLTKIDLSSENELASTVSTPVSKTAELSPKNLLSPSSFKAECSEDVENLNAPPAEAGY
DQNKTDFDETSSINTAISDATTGDEGNAEMESTTGSSGEVKPALSPKEGKTLDTLPKTAT
TPTTEVCDEKFLFSLTSPSIPFSDKDGDHDQSFYITDDPDDNADRSETSSIADPSSPNPF
GSSNPFKSKSNDRPGHKRFRTQMSNLQLKVLKACFSDYRTPTMQECEMLGNEIGLPKRVV
QVWFQNARAKEKKFKINIGKPFMINQSGTEGAKPECTLCGVKYSARLSIRDHIFSKQHIS
KVRETVGSQLDREKDYLAPTTVRQLMAQQELDRIKKASDVLGLAVQQPSMMDSSPLHGIS
LPAAYPGLPGLPPVLLPGMNGPSSLPGFPQNSNTLTPPGAGMLGFPTSATSSPALSLSSA
PTKPLLQTPAPPPPPPPPPPPPPPSLSGQQTEPQNKDSEKKPTKPNKVKKIKEEELEATK
PEKHPKKEEKISSALSVLGKVVGDTPVDPSQLQALQNAIAGDPASFLGGQFLPYFIPGFA
SYFTPQLPGAVQGGYLPPVCGMESLFPYGPTMPQTLAGLSPGTLLQQYQQYQQNLQESLQ
KQQKQQQEQQQKALQAKTSKAESEQLPPNPSDASETKGDKSPATESTKEEPQLESKSADF
SDTYVVPFVKYEFICRKCQMMFTDEDAAVNHQKSFCYFGQPLIDPQETVLRVPVSRYQCL
ACDVAIGGNEALSQHLQSSLHKEKTIKQAMRNAKEHVRLLPHSVCSPNPNTTSTSQSAAS
SNNTYPHLSCFSMKSWPNILFQASARRAASSPSSPPSLSLPSTVTSSLCSTSGVQTSLPT
ESCSDESDSELSQKLEDLDNSLEVKAKPASGLDGNFNSIRMDMFSV
Download sequence
Identical sequences F1MPW8
ENSBTAP00000053369 ENSBTAP00000053369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]