SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053544 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053544
Domain Number 1 Region: 233-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000124
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 266-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000543
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053544   Gene: ENSBTAG00000044097   Transcript: ENSBTAT00000061201
Sequence length 302
Comment pep:known chromosome:UMD3.1:2:95781394:95903310:-1 gene:ENSBTAG00000044097 transcript:ENSBTAT00000061201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLRASPPPCIEESFRRLDPLLLPVEATICEKSSAVDILLSRDKLLSETCLSLQPTSSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALGSVKVGG
VATAAAAVAAAGTVKSGHSDSEQGGVGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
HI
Download sequence
Identical sequences A0A161HGV6 E1BNF7
9913.ENSBTAP00000053544 ENSBTAP00000053544 ENSBTAP00000053544 NP_001179848.1.59421 NP_001179848.1.76553 XP_005676483.1.57651 XP_005908365.1.15283 XP_005979625.1.78601 XP_006051398.1.26621 XP_010859359.1.44457 XP_012004400.1.54773 XP_012004401.1.54773 XP_019831450.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]