SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053548 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053548
Domain Number 1 Region: 3-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-73
Family Calponin-homology domain, CH-domain 0.00000445
Further Details:      
 
Domain Number 2 Region: 1486-1689
Classification Level Classification E-value
Superfamily Plakin repeat 6.8e-41
Family Plakin repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 1694-1877
Classification Level Classification E-value
Superfamily Plakin repeat 1.96e-38
Family Plakin repeat 0.00056
Further Details:      
 
Domain Number 4 Region: 6290-6408
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-28
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 6465-6624
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-28
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 216-332
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 6706-6841
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-25
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 8 Region: 5804-5963
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-24
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 9 Region: 4507-4668
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 10 Region: 6045-6185
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-22
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 11 Region: 6836-6952
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-21
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 12 Region: 5697-5849
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-21
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 13 Region: 7199-7278
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 14 Region: 4039-4196
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-20
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 15 Region: 6902-7029,7059-7090
Classification Level Classification E-value
Superfamily Spectrin repeat 2.79e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 16 Region: 4840-4994
Classification Level Classification E-value
Superfamily Spectrin repeat 7.1e-19
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 17 Region: 6625-6735
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-18
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 18 Region: 5411-5528
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-17
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 19 Region: 5053-5213
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000101
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 20 Region: 7110-7190
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000141
Family Polcalcin 0.044
Further Details:      
 
Domain Number 21 Region: 650-752
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000245
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 22 Region: 1186-1313,1340-1368
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000307
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 23 Region: 5477-5626
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000072
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 24 Region: 6179-6298
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000892
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 25 Region: 3814-3923
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000908
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 26 Region: 5179-5317
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000916
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 27 Region: 5277-5398
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 28 Region: 4728-4850
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000184
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 29 Region: 5962-6074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000734
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 30 Region: 4256-4376
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000174
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 31 Region: 557-649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000589
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 32 Region: 4414-4523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000547
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 33 Region: 731-832,953-973
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000907
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053548   Gene: ENSBTAG00000021237   Transcript: ENSBTAT00000061451
Sequence length 7493
Comment pep:known chromosome:UMD3.1:23:3431407:3687495:1 gene:ENSBTAG00000021237 transcript:ENSBTAT00000061451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLV
NIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGI
RCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPE
DVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLVQWIRHHV
ATMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQ
GYHPNDIEKEWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRGSVICEDKLLLARNAL
QSDSKRLESGLQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRD
DIMALRNECSSVYSKGRVLTTEQTKLMISGISQSLNAGFAQTLNPSMNSGLTQGLTPSLT
PSSVTSGLSSGLTSRLTPSVTPAYTPGFPSGLVPSFGSGGETSSLQTLKLMQIRKPLLKS
SLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEF
ESSLKEAKISEIQMTAPLKLTYAEKLHRLENQYAKLLNTSRNQERHLDTLHNFVTRATNE
LIWLNEKEEEEVAYDWSERNTNIARKRDYHAELMRELDQKEETIKSVQEIAERLLLENHP
ARLTIEAYRAAMQTQWSWILQLCQCVEQHVKENSAYFEFFNDAKEATDYLRNLKDAIQRK
YSCDRSSSIHKLEDLVQESMEEKEELLQYKSTVASLMGRAKTIVQLKPRNADCPLKTSLP
IKAICDYRQIEITIFKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDL
ANRIEQQYQNVLTLWHESHINMKSVVSWHHLINEIDRIRASNVASIKTMLPGEHQQVLSN
LQSRFEDFLEDSQESQIFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESAYNLYISE
VRNLRLRLESCEDRLIRQIRTPLERDDLHESVFRISEQEKLKKELERLKDDLATITSKCE
DFFSQAPASASTPALRSELSVVVQSMNHVYSMSSTYIEKLKTVNLVLKNTQAAEALVKLY
ETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKREVFHELEDELQRAKTISDEMFKTYK
ERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHLLDDWIQQVET
TQRKIQENQPENSKALATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSTAVKDYELQTMT
YRAMVDSQQKSPVKRRRMQSSADLVIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEE
EKSLEEEKKEHVEKVKELQKWVSNISKTLRDGEKAGKSSFSKQKISSEEISIKKEQLSET
LQGMQLFLAKHGDKMTDEERNELEKQVKTLQESYNLFFSESLKQLQQLQTLGDIKVEEKL
DKVIAGTVDQSTGEVLSVFQSVLRGLLDYDTGIRLLETQLMISGLISPELRTCFNLKDAQ
SHGLIDEQVLSQLQELNEMKEIISAVSSTRVPVLDALAEGVISEPMAIRVLEILLSTGSL
VIPATGEQLTLQKAFQQHLVSSALFSKILERQSLCKDLIDPSTSEKVSLIDIMQRSVLQE
DLGMRLLPVRPQEGGRITLKCGRNVSILRAAHEGLIDRETMFRLLGAQLLSGGLINSKSG
RRLTVEEAVAEGVMDRDTANSILTYQVETGGIIRCNPAKRLTVDEAVQCNLIPSSSALLV
LEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELASKILEGRQKIAALYIPETCQVIDLE
VATQLGIIDNYTASILKSITLPDKMPNLGDLEACKNARRWLSFCKFQPSMVHDYRLDEDA
FDGEEPVATQSSEQTKKLFLSYLMINSYMDANTGQRLLLYDGDLNEAVGMLLEGCGAEID
KDTPIEECFDVLRLPGVSLNNTASKEMGESPASPSSFDKCHQREPEHKVTPENTIDEEFQ
ELEINVIRSEFWLSENLADVITTDLKVKKSPGVSVPSSRSHLTQLGLADVSLPRQDSENR
VENGENQCQLETKEHADECSHSKNLQNLASDLITDPMIKSKTSRAYDLNETENEDNISRG
SVLFDYSPRLSALLSHDKLRTEQGSFHDVHSAESNGKKCETSTLPFNDQTESSGQRIREK
FQDQFLGIAAINISLKGEQAEEKSFNVGCSNPQVECQSDEFSSDTCDEDENALATSQQEP
EDENRESTVEGSSGAPTPRAGGHDVVLAPTHTPSFEGTVGASAGDYETSLLDDRCSETDT
DSDADFYDTPLSEDDDHDSLLLEGDDCDCLQPEDYDSLPEEDEWAAPPGEVFYDVSKEEE
HSVGTQAGLAESLGVRGGAQSLQDFLIGAEKAELGSGEEIQLNSFESYEVSGPLMETVSE
RDSTDDLEGDESDSLTDYETEGGKESFTMAVESEDAGCWEGREKDCVAGQGFESAPDHLD
SVQSKDSYEESVSGPNEQDDDDRGADAGDGAGGEGAEPVGQGAAAAVVVPGCVAAAPETE
NSHASQRNNKTILLTQKHHHNSKQKQQCVNVLQPESSSKSSLGPEINCFPEDTNEVVGKS
IEDLLNHEMVLQDELLPIMKDTESENIFSPVGALPNTSVSSASELKGHLKNTGLELIQPG
SADSVKGGNPYCENVTLRGNSSSDKIICPEPSLTGKPAEESHLSFTMSVADNDPPGSGRD
LIKRTADKSNVQIEDEASLPKMCAGKGEVLIEGPLEDKYPKLLPSKSTRESLDIVNSLFP
VPQTIHSEEHSQEESLKNTAVALKDEPQNLPTVVSRSPVQFENLEEIFDSSVSQVINDDM
TSDVTLSEGFTKIETDSLTDGPEDELDLFTYLKHCAKDVKAKDVLKPGEDTPSCIPVTSP
PIKEHLQLGVNNADEKAALAQEDSPPKEMGQQKDLPAEESRSGIPKLTPAGDESMPSGFP
LGNAEGLGKHMDFVQSDLCADGVRNNSSKALSTDCSSLEIHSEKEGIEQQKGKEPAPSPG
AQGSKVQVAELSQVLVEDITDTLKGNLKEGRVTPQELGKPSACADANILIQTFIKRVSSS
QLVNETPGVPSNSNTSGCGISCAKNSESREDPLCAANLKSELLLDILKQSQYSQKVIGAF
ELMKELTQMECDLEEKGGASELLPLQLEDIFCKLLPDGYSEKGGQHTDLSKKSPTAPEVT
DEEPHILEEFNSKEGNPCSLNLQSVKESGPENSPVCAPALSRDGRLKELCAASPGHLECI
SGSEDLASGDSLMERFSKELQQCLQHRSKMCEYLALLQDMKPPFGSQDSRDGSLEALRDQ
LKQLETFELGLAPIGVILRKDMTLAEEFVKSVPSDFPRGPLEDLSMSLQSLQTALSSLQA
VSSERMSHITLAIDSEVSKLAVSHEEFLQKLQSFSCWISETSKSVKDVEIMTVRDAELIK
QSLEFLKNVLKDLGHTKTQLETTAFDVQFFISEHAQDLSPTQSRQLLRLLNTTQKGFLDM
QDSVTTQVEHLEAQLQLEQDLDHQKLVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFV
IGDGTAELKKYQSKQEELQKDMQGSAQALAEIVKNTENFLKESGEKLSQEDKAVIEQKLN
EAKIKCEQLTIKAEQSKKELDKVVTTAIREETEKVVAAKQLEESKTKIENLLDWLANVER
DSGRAAMEPKQIIEQNGTHFQEGDGKLMMGEEDEFNGNLLDTDVDGRVGTTEENLNQQYQ
KMKAQHAELVAQQQAVLAATQAAQALLETQGHHLCPEEKEKLQRNVTELKTHFESALAAS
ETAVRRTRSLQEELQKFDTDCGEFEQWLQQAEQDLQNLEAGADDLRGLTAKLKRQKSFSE
DVISHKGDLRYITISGNRVLEAAKSCGGREGGGRADRDQVDTSAAHREVQGRLDRATERF
RSLYTKCNVLGNNLKDLVDKYQHYEDASSGLLSGLQACEASPVFPLSRWIVIDYSQLDRN
LKAAKEALQGQISSQQVAVEKLKKTAEVLLDSRASLLPAKSDIQKTLDDIVGRYDDLSAS
VSERNEKLQMTLTRSLSVQDGLDEMLLWMEGVERCLQEPCQLPLSSTALQDVISKSIMLE
QDIAGRQSSINAMNEKVKRFTETTDPSTASSLQARMKDLAFRFSEASHKHKEKLAQVEKL
KTKVERFENLSEKLHTFLEAKTQALTEADVPGKDVTELSQFMQESTSELLERKKDLEVLQ
NLLKEISSHGLPGDKALVFEKTNNLSKKFKEMEDTVKEKKEAVSSCQEQMGAFQVLVKSL
KSWIKETTERVPVVQPSFGAEDLQKSLEETKKLQEKWSLKTPEIQKVSDSGNSLCNLISA
VTTPAKAIAAVKSGGVILNGEGTATDTQEVLANKGLTSIKKDMTDISHGYEDLGLLLKDK
IGELSTKLSRLQKAQEESSAMMQWLQTMSNTATKWHQAPTPVDTEAVKSQVEQNKLFDAE
LKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTVDRQQKLEESS
NTLTQFQTVEAQLKQWLVEKELMVSVLGPLSVDPNMLNTQRQQVQILLQEFDTRKPQYEQ
LTTAGRGILQRPGEHPSLHGTVKEQLAAVTQKWDSLTGQLRDRCDRIDQAVGKSTQYQSL
LRSLSEKLADLDDQLSSSVAGSAHPDAMSQQLETAQKLKQAVEQEGKRISAAQALGDDLA
ALVREEYLRAELSRQLEGVLKSFKDLEQKAETHVEHLQSACASSHQFQQMSRDFQAWLDT
KKEEQNKSPLISAKVDVLESLVKDQKDFRKTLTAQSHLYEKTIAEGENLLLKTQGSEKVA
LQLQLNTIKTNWDGLQKQVKDREDRVKDTLERALKYKEHVDTLRPWIDRCQGSLEEIKCS
LDPAETENALARLKALQKEMDQHFGLVEQLSGAAGSLLGVCEVDQEVVAEERECLLRKVD
TVTEQVHRKKFSLENMAQKFKEFQEVSREAQRQLQGAKDQLAVHDSLGPQAHSSKSLTVL
QTQQKALQTLKSQVDLAQGLARDLVAEASDSKGTSEILLQAETLAQEHDSLSQQVDDKCS
FLETKLQGIGHFQNTIREMFSQFAEFDDELDGMAPVGRDAETLQKQKEAIRAFLEKLDAL
IANNANANKTCKMMLATEEASPDLVGIKRDLEALSKQCNKLWDRAQARKEQVEGTIVRLE
EFYSKLQEFSTLLQKAEELEESQGPVGMETETINQQLDVFKVFQKEEIEPLQVKHQDVNW
LGQGLIQSAAKGASTEALEHDLDDAGARWKTLNKKVVAQRAAQLQEALLHCGRFQDALES
LLSWMGDTEELVANQKAPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIVDSR
WEALLSKAETRNRQLEGISVVAQQFHETLEPLNEWLSTTEKRLANCEPVGTQASKLEEQI
EQHKALEDDILHHNKHLHQTVSIGQSLKVLSSREDKDMVQSKLDSSQVWYIEIQEKSHSR
SELLQQALCNAKIFGEDEVELMNWLSEVHDKLRRLSVQDSSPEGLWTQQAELRVLQEDIQ
LRKQNVDQALLNGLELLKRTTGDEVLIIQDKLEAIKARYQDITKLSTDVAKTLEQALQLA
RRLQSTHEELCAWLDKVEVELLSYETQVLKGEAASQAHASLRPQELKKEAKSHKALLDSL
NEVSTALLELVPWRAREGLERTVAEDNDRFRLVSDAVAQRVEAIDAALLRAQQFDQAADA
ELAWINETEKKLTSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDELVKSGHKIMSTC
SEEEKQPMKKKLDTVLKNYDAICQVNSERYLQLERAQSLVSQFWETYEELWPWLTDTQKA
IAQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPREGFSIQEKY
VAADTLYSQIKEDVRKRAVALDEAISQSTQFHDKIDQILESLERVVERLRQPPSISAEVE
KIREQVSENKNVAVDMEKLQPLYETLRQRGEEMIARSQGTDKDISAKAVQDKLDQMVFIW
ENIHVLVEEREAKLLDVMELAEKFWCDHLSLVVTTKDTQDFIRDLEDPGIDPSVVKQQQE
AAEVIREEIDGLQEELDMVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRV
DRLEEAMQTAVQYQDGLQALFDWVDIAGGKLASMSPIGTDLETVKQQIEELKKQQFKSEA
YQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLDERIINRQHKLEGALL
ALGQFQHALDELLAWLTHTEGLLGEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAV
NKAGNDLIESSAGEEASSLQNKLEVLNQRWQNVLEKTEQRKQHLDAALRQAKGFHGEIED
LQQWLTDTERHLLASKPLGGLPETAREQLNAHLEICAAFDVKEETYKNLMQKGQQMLARC
PKSAETNIDQDINNLKEKWESVETKLNERKVKLEEALTLAMEFHNSLQDFINWLTQAEQT
LNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNL
LISVQSRWEKVVQRLVERGRSLDEARKRAKQFHDAWSKLMEWLEESEKSLDSELEIANDP
DKIKTQLAQHKEFQKSLGAKHSVYDTTSRTGRSLKEKTTLADDNLKLDDMLSELRDKWDT
ICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNH
KVFQKELGKRTSSVQALKRSARELIEGNQDDSSWVRVQVQELSTRWETVCALSISKQSRL
EAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDALRTLIDQHKEFMKRLEEKRA
ALNKATSMGDAILAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQ
ELLEALLAWLQWAETTLSDRDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTY
KRRAADPSSLQSHIPVLDKGRAGRKRLPAPSFYPSGSQTQIETKNPRVNLLVSKWQQVWL
LALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKI
TRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPITDADK
IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGW
MALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGATQG
MAAFRPRGRRSRPSSRAASPSRSTSVSGQAGQAASPQVPASSTPKGTPIQGSKLRLPGYL
SGKGFHSGEDSGLITTAAARVRTQFADPRRTPSRPGSRAGSKAGSRASSRRGSDASDFDI
SEIQSVCSDVETVPPTHRPTPRAGSRPPGAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences F1MPT5
ENSBTAP00000053548 ENSBTAP00000053548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]