SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053570 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053570
Domain Number 1 Region: 26-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000476
Family Classic zinc finger, C2H2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053570   Gene: ENSBTAG00000013925   Transcript: ENSBTAT00000061405
Sequence length 392
Comment pep:known chromosome:UMD3.1:13:16187650:16210886:1 gene:ENSBTAG00000013925 transcript:ENSBTAT00000061405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSDFLTPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASEN
PQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTK
WLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDDEEKTAKFIQEQVRRG
LEGKEQEVPVFTELSRENDEEKVTFNLNKGACSSGAASSKSSSLGPSALKTIGTVASVKR
KESSQSSAPSKEKKKKKSALDEIMEIEEEKKRTARTDYWLQPEIIVKIITKKLGEKYHKK
KGIVKEVIDKYTAVVKMIDSGDKLKLDQTHLETVIPAPGKRILVLNGGYRGNEGTLESIN
EKTFSATIVIETGPLKGRRVEGIQYEDISKLA
Download sequence
Identical sequences E1BND1 L8IK98
ENSBTAP00000053570 ENSBTAP00000053570 9913.ENSBTAP00000053570 XP_005895561.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]