SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053606 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053606
Domain Number 1 Region: 44-162
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.62e-42
Family Frizzled cysteine-rich domain 0.0000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053606   Gene: ENSBTAG00000040128   Transcript: ENSBTAT00000061370
Sequence length 537
Comment pep:known chromosome:UMD3.1:29:8669606:8673380:1 gene:ENSBTAG00000040128 transcript:ENSBTAT00000061370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWRGAGPRVLGGPGGVGLSPRLLLLLLLLVEPVRGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKVNIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDVWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGRGNETVV
Download sequence
Identical sequences F1MLJ8
ENSBTAP00000053606 NP_001193198.1.59421 NP_001193198.1.76553 XP_019810329.1.53367 9913.ENSBTAP00000053606 ENSBTAP00000053606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]