SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053629 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053629
Domain Number 1 Region: 218-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-19
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 182-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000251
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 266-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000426
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053629   Gene: ENSBTAG00000044139   Transcript: ENSBTAT00000061004
Sequence length 296
Comment pep:known chromosome:UMD3.1:27:16630109:16630996:1 gene:ENSBTAG00000044139 transcript:ENSBTAT00000061004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQQLKKRGTTPSQKGLGRRATSTDKSLPAQQEPPDTTCILYDEDVCYEASFRVVKDDTF
SDCYIECIIRGEFSEPIVEEDPLLQSFERLKEGSEQDLSQQVLAASSLLESSLEYMKRDA
KQEFPQQVVGENPLLEFSEYKTSKKLPPGGIPNMDFPESKQLTGCTRRPSTNKEYGAPER
HACPHNGCTREFQNKRSLRKHLRVHNPRDHVCAECGKAFKESAKLKRHFLVHTGEKPFPC
TFQGCGKRFSLSFNLRTHVRTHTGEKPFVCPFVGCRKKFIQSNNMKAHLLTHGKAN
Download sequence
Identical sequences E1BML4
ENSBTAP00000053629 ENSBTAP00000053629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]