SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053646 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053646
Domain Number 1 Region: 1016-1068
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000234
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 273-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000832
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 3 Region: 980-1031
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000308
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 206-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000597
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 648-693
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000175
Family Homeodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053646   Gene: ENSBTAG00000012615   Transcript: ENSBTAT00000061551
Sequence length 1209
Comment pep:known chromosome:UMD3.1:2:52275074:52406207:1 gene:ENSBTAG00000012615 transcript:ENSBTAT00000061551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKPQIAEEDGIANPLDQERSPASV
PNHESSPHVSQALLPREEEEDEIREGGVEHAWHNSDILQASVDGPEEMKEDYDTMGPEAT
IQTTVNNGTVKNANCTSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAPEELSR
LGTPEANGQEENDLPPGTPDAFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEENFSCPL
CSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHS
GEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTGSSPNSVSSSPTNSA
ITQLRNKLENGKPLSMSEQTGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGALGATSP
LGVHPSAQSPMQHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKAEEISK
LKGYHMKDPCSQPEEQGVTSPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACLQSLTT
DSRRQISNIKKEKLRTLIDLVTDDKMIENHNISTPFSCQFCKESFPGPIPLHQHERYLCK
MNEEIKAVLQPHENIVPNKAGVFVDNKALLLSSVLSEKGMTSPINPYKDHMSVLKAYYAM
NMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRSPSLERNSKPLAPNSNPPTKD
SLLPRSPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSP
LNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKSKTKVGSINLD
HNSVSSSSENSDEPLNLTFIKKEFSNSNNLDSKSANPVFGMNPFSAKPLYTALPPQSAFP
PATFMPPVQTSIPGLRPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKPGFQGEL
LDGAQDYMSGLDDMTDSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKR
PHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREA
EEREAAEREAREKGHLEPTELLMNRAYLQSITPQGYSDSEERESMPRDGESEKEHEKEGE
DGYGKLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKMETKSDH
EEDNMEDGM
Download sequence
Identical sequences E1BE33
ENSBTAP00000053646 ENSBTAP00000053646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]