SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053666 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053666
Domain Number 1 Region: 321-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 593-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000038
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 676-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000204
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 4 Region: 478-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000135
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 5 Region: 636-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000823
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 561-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000164
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 443-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000448
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053666   Gene: ENSBTAG00000039313   Transcript: ENSBTAT00000061145
Sequence length 853
Comment pep:known chromosome:UMD3.1:13:63750180:63790156:1 gene:ENSBTAG00000039313 transcript:ENSBTAT00000061145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTIFEALEGMDNQTVLAVQSLLDGQGAVPDPTGQSVSAPPAIQPLDDEDVFLCGKCKK
QFNSLPAFMTHKREQCQGSALPLATVSLATNSIYTPSAAPSAIQQAPPPPNRQVFIHSFH
LTYITVPPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPQGPQPVQSNLNMHPAPNY
LAQPPPPPPPPPPLPPPPPPQPPPPPPQSLGPAGRPNPGGNGVVEVYNATAPLTGSGTVE
IQALGMQPYPPLEVPNQCVEAPVYPTPQVYSPGKQGFKPKGPNPAAPMTSATGGTVASFD
SPPSLKTRRTKAAGKPKAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFAQ
KSNVKKHMQTHKVWPPGRSGGTVSRNSVTVQVMALNPSRQEDEDNTGLGQTLSSAPQPQA
LPTAGEGEGDKLEAKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKCVVKSCA
QTFPKLDTFLEHIKSHQEELSYRCHLCGKDFPSLYDLGVHQYSHSLLSQNSPKKDSAVYK
CVKCVNKYSTPEALDHHLQTATHNFPCPHCQKVFPCERYLRRHLPTHGSGGRFKCQVCKK
FFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSTHTGCS
KEFNRPDKLKAHILSHSGMKLHKCALCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGFS
RHKYLKDHRCRLGPQKDKDLQARRPPRRRAAPRSGSGGGHKVVTPLPDPLGLEELKDTGA
GPMPEAAPGKPPFSEPDAVLSIVVGGTVGGEPELVVPGHAEGLGSNLALAELQAGAEGSC
AMLAVPVYIQASE
Download sequence
Identical sequences E1BE18
ENSBTAP00000053666 NP_001179505.1.59421 NP_001179505.1.76553 ENSBTAP00000053666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]