SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053787 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053787
Domain Number 1 Region: 135-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000386
Family Classic zinc finger, C2H2 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053787   Gene: ENSBTAG00000038316   Transcript: ENSBTAT00000061184
Sequence length 1509
Comment pep:known chromosome:UMD3.1:19:44817719:44889648:-1 gene:ENSBTAG00000038316 transcript:ENSBTAT00000061184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVSNFNVYHKSCFFQGNHFDQYEEGHLEIEQASLDKPIESDNIGHRLLQKHGWKLGQGLG
KSLQGRTDPIPIVVKYDVMGMGRMEMELDYAEDATERRRVLEVEKEDTEELRQKYKDYVD
KEKAIAKALEDLRANFYCELCDKQYQKHQEFDNHINSYDHAHKQRLKDLKQREFARNVSS
RSRKDEKKQEKALRRLHELAEQRKQAECAPGSGPMFRPTTVAVDEEAGDDEKDESATNSG
TSTAAACGLGSEFSTDKGGPFTAVQITNTTGLAQAPGPASQGISFGIKNNLGTPLQKLGV
SFSFAKKAPVKLESIASVFKDHAEEGTSDDGTKADEKGADQGLQKVGDSDGSSNLDGKKE
DEDPQDGGSLASTLSKLKRMKREEGAGATEPEYYHYIPPAHCKVKPNFPFLLFMRASEQM
EGDNSTHPKNALDSKKSSSPKPKGCIKVTASQGPEKTVSEVSEQQMETSAAEPSEPGSKA
ETKKPSGGDVSEHSLEIQSQKDSEIQMCESDPHKETSQATPAGRESREGPKHPTGPFFPV
LSKDESTALQWPSELLIFTKAEPSISYSCNPLYFDFKLSRNKDARAKGTEKPKDIGGSSK
DHLQGLDPSELHKSQEEEESVQHSSGGRIDAPASGAACSGLNKQEPGGSHGSETEDTGRS
LPSKKERSGKSHRHKKKKKHKKSSKHKRKHRADPEEKSSKAESGEKSKKRKKRKRKKNKS
SAPADSERGPKPEPPGSGSPAPPRRRRRAQDDSQRRSLPAEEGSSGKKDEGGGSGSAQDH
SGRKHRGEPPASSCQRRAGTKRSSRSSHRSRPSSGDEDSDDASSRRLHQKSPSQYSEEEE
EEEEEEEESGSEHSRSRSRSGRHHSSRHSSRRSYSSSSDASSDQSCYSRQHSYSDDSYSD
YSDRSRRHSKRSHDSDDSDYASSKHRSKRHKYSSSDDDYSLSGSQSRSRSRSHTRERSRS
RGRSRSSSCSRSRSKRRSRSTTAHSWQRSRSYSRDRSRSTRSPSQRSGSRKGSWGHESPE
ERRSGRRDFIRSKIYRSQSPHYFRSGRGEGPGEKKKEDGRGDDGKGIGPPSQNSSVGPGR
GSEGDCSPEDKNSVTAKLLLEKIQSRKVERKPSMSEEVLATPNKAGLKLKDPPQGYFGPK
LPPSLGNKPVLPLIGKLPATRKPNAKKCEESGLERGEEQEQSETEEGPPGNSDAPFGHQF
PSEETAGPLSDPPPEEPKSEEATADHPVAPLGTPVHSDCYPGDPSISHNYLPDPSDGDTL
ESLDSGSQPGPVESSLLPIASDLEPFPGYAPPSGEPSIESVDGAEDASLAPLESQPITFT
PEEMEKYSKLQQAAQQHIQQQLLAKQVKAFPASAALAPATPALQPIHIQQPATASATSIT
TVQHAILQHHAAAAAAAIGIHPHPHPQPLAQVHHIPQPHLTPISLSHLTHSIIPGHPATF
LASHPIHIIPASAIHPGPFTFHPVPHAALYPTLLAPRPAAAAATALHLHPLLHPIFSGQD
LQHPPSHGT
Download sequence
Identical sequences E1BC37
ENSBTAP00000053787 ENSBTAP00000053787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]