SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053886 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053886
Domain Number 1 Region: 19-93
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.74e-23
Family SCAN domain 0.00017
Further Details:      
 
Domain Number 2 Region: 182-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000111
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053886   Gene: ENSBTAG00000046111   Transcript: ENSBTAT00000065840
Sequence length 250
Comment pep:known chromosome:UMD3.1:18:63725628:63729366:1 gene:ENSBTAG00000046111 transcript:ENSBTAT00000065840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALGLGPVNQDRGAAEGLTADSPWHRFRHFHLGDAPGPREALGLLRALCRAWLRPEVRT
KEQMLELLVLEQFLSALPARRQKYCRSSRPSDRTHVSCIGQKLWGPATRAPQDATGGSGV
GVEEEAGGATPSGDAAPRPEEPATADAQAARPYKQEPGSPLKPPDPPAPGLPAFLAAPAT
ASCPDCGKASLKPAHLLRHRQSHSGEKPHACPECGKAFRRKEHLRRHRGTHPGGPGPALR
PLPAREKPHA
Download sequence
Identical sequences G3MWI6
ENSBTAP00000053886 ENSBTAP00000053886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]